Conserved Protein Domain Family
Bclx_interact

?
pfam08945: Bclx_interact 
Bcl-x interacting, BH3 domain
This domain is a long alpha helix, required for interaction with Bcl-x. It is found in BAM, Bim and Bcl2-like protein 11. This domain is also known as the BH3 domain between residues 146 and 161.
Statistics
?
PSSM-Id: 401044
View PSSM: pfam08945
Aligned: 6 rows
Threshold Bit Score: 47.9633
Threshold Setting Gi: 1335184119
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002610635 411 FRARSRSEPVRVSPEELVARELRRISDEFDSLVFSPtqRR 450 Florida lancelet
XP_023601760   1 MQQSQALPVDMRPEMWIAQELRRIGDEFNNSYRNPR--RD 38  little brown bat
O54918       129 SIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYT----RR 164 house mouse
XP_007476637 136 SMRQSQSIPADMRPEIWIAQELRRIGDEFNASYYPR--RG 173 gray short-tailed opossum
XP_015676417  76 SRWQSRPIPEDMQPEIWIAQELRRIGDEFNASYCPR--RG 113 Protobothrops mucrosquamatus
OXB74305       9 SRWRSHSLAEEIQPEIWIAQELRRIGDEFNASYCPR--RG 46  northern bobwhite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap