2FGY


Conserved Protein Domain Family
CsoSCA

?
pfam08936: CsoSCA 
Carboxysome Shell Carbonic Anhydrase
Carboxysome Shell Carbonic Anhydrase is a bacterial carbonic anhydrase localized in the carboxysome, where it converts bicarbonate ions to carbon dioxide for use in carbon fixation. It contains three domains, these being: (1) an N-terminal domain composed primarily of four alpha-helices; (2) a catalytic domain containing a tightly bound zinc ion and (3) a C-terminal domain with weak structural similarity to the catalytic domain.
Statistics
?
PSSM-Id: 401035
View PSSM: pfam08936
Aligned: 23 rows
Threshold Bit Score: 643.914
Threshold Setting Gi: 146192107
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FGY_A         79 HPLTDLEANEQLGRCEDSVKNRFDRVIPFLQVVAGIPLGLDHVTRVQELAQSSLGHTLPEELLKDNWISGHNLKG----- 153
Q3SFK7         62 HPLIDAVRNAELAEYERTVRERFDAIVPTLKEIAGLQHEAGFEQRAQQIAGERLGFTLPEAVLADAWITTLDMRA----- 136 Thiobacillus d...
WP_015797596   52 HPLTDHAANERLARFERLVRGRFDAVVPTLKAIGTLAPTDDLAERAASMARAELGVALPAELFESAWITGLDMRR----- 126 Acidimicrobium...
CAS:Atc_0929   62 HALVQPSENARLAEIEKSVKGSFDAIVPALKSMAALGRGPDFPEQAQQLARQELGFEFPQEVLERAWVRGPELGR----- 136 Acidithiobacil...
jgi:Tgr7_3200  56 HPLADQEANEALYGYERGFRERFARLVPVLKEVHALQHEPDFELRAQDLVQRTLGYQLPESMLADAWIRDLDTRA----- 130 Thioalkalivibr...
jgi:TK90_0861  28 HPLADVADNERLYAFESGFRDRFANLVPVLKEVHALQHERDFEEKAQRIVEDNLGYRLPERVLEDAWINDLDTRE----- 102 Thioalkalivibr...
WP_013121930   56 HALVDSELNCRLSDYERIVRGRFSGIVDVLKEISALQHERDFAERAQRLAQERLGYALPQQLLDDAWVSGLDMKA----- 130 Thiomonas inte...
Q1QFR7         45 HALVDRDLNRLLFDYEQKVRSRFTRIVDVLKRISTYQHDENFTERAQQHAREQLGFDLPSQVLEDAWVCGLDLSA----- 119 Nitrobacter ha...
Q31HD6         60 HALVNERQNEWLRGYEVDIKSRFDNIESVLKDILAQQSQLNFVSWANQQLFAKLGVSLT----EQDWQSGVQLQSqkgfq 135 Hydrogenovibri...
WP_012971924   48 HPLTRLDENQRLWAYEQRIKDAFARIVPTLKSIAARVPDAGFEDWAQAEARQKLGFELPESRLADAWVAGLDRRA----- 122 Allochromatium...
2FGY_A        154 -IFGYATAKALTAATEQFSRKIMSEKDDSa-SAIGFFLDCGFHAVDISPCADGRLKGLLPYILRL-PLTAFtY-RKAYAG 229
Q3SFK7        137 -LYGHSVLQTYHWLARDFTARWDGHAEAQ--AVERFFIECGFHEVDISSCADGRLKGLLQFVLRL-PHQAV-HrRKSYAG 211 Thiobacillus d...
WP_015797596  127 -LYAVTMAETIHAVAAETHAFAGTESD----TMTGFLLECGFHAVDISPCSDGRLKGVIRSILRL-PDDAV-RsRKAYAG 199 Acidimicrobium...
CAS:Atc_0929  137 -LYAEGTFMALERAVCEFGARIQTELRAAq-NLDAFLVDCGFHALNVSACADGRLKGLFPFILRL-PDSPL-VsRSAFAG 212 Acidithiobacil...
jgi:Tgr7_3200 131 -LYLHGMFEMFDQVVNEHWQGRDDLIADAe-RAIAYFLDCDFHEVDITPCSDGRLLGLRRFILRL-PALAV-R-VRSYAG 205 Thioalkalivibr...
jgi:TK90_0861 103 -LYLHGTFELFDQLVNEYWAGRDDLVDEAe-RAIAYFLDCDFHEVDISPCSDGRLLSLRRFILRL-PDLAV-R-VKSYAG 177 Thioalkalivibr...
WP_013121930  131 -LHTHCIFQSFKVCVDRTDADQSLWLNRMa-LTPEFLAACGYHTVDVTPCADGRLQGLLPFVFRMaPNRNV-Y-LKAYAG 206 Thiomonas inte...
Q1QFR7        120 -LHSRCTFSSLKSCVENAQAEQAGWRQRMp-LDENFLRSCGYHTVDISPCSDGRLQGVSPYVLRIlPGPNV-W-VKAYAG 195 Nitrobacter ha...
Q31HD6        136 fLYGKTLFAQFMRMSEDFFVNDPLSGQRKq-EAERMFKEAGFHAVGIAPCADGRLAHILSYVLRL-PYALA-R-RKAHAG 211 Hydrogenovibri...
WP_012971924  123 -LFAHATFETVRAMSDDYFTTDPLDDRGQsdEFRRFLLDCGFHAMNVTPCSDGRLAHAIRYVLRL-PMGAV-Q-RRANAG 198 Allochromatium...
2FGY_A        230 SMFDIEDDLAQWEKNELRRYREGVPNTADQPTRYLKIAVYHFSTSDPTHSGCAAHGSNDRAALEAALTQLM-KFREAVEN 308
Q3SFK7        212 ALFDVELNVKHWTETELRRFREGVPTTSDAGTRYLKIAVYHFSSSDPEHEGCAAHGSDDTRAAQAALDRLA-AFRTAIEN 290 Thiobacillus d...
WP_015797596  200 AMFDVEANVRRWIETELLRFREGSPVPPSAGTRYLKIAVYHWSRSDPDYEGCAAHGSDQRAAAAAALSRLR-ELREAVEN 278 Acidimicrobium...
CAS:Atc_0929  213 TLFDIEEDVRHWQAAELRRFREGYPTTADAQTRYLKIAVYHGSSVDPQHQGCAAHGSNLHAAIEAALERLY-QFRMAIEN 291 Acidithiobacil...
jgi:Tgr7_3200 206 ALFDIEEGVQHWTRRELIRHREGVPTSADVPSRYLKIAAYHYSSSKPNQEGCAAHGSNERDAAEAALLQLR-SFRQAIEN 284 Thioalkalivibr...
jgi:TK90_0861 178 AQFDIEEDVRHWTKRELLRFREGRPTTADVPSRYLKIAAYHYSSADPHHQGCAAHGNSERDAADAALRQLR-AFRQAIEN 256 Thioalkalivibr...
WP_013121930  207 AMFDVEADMVDWGHREIERLSGGIPG--GESQNYLKIAVYHFSSSHSHEQGCAFHASNDKQAVESAKQRLD-ELRIAIER 283 Thiomonas inte...
Q1QFR7        196 ALFDVEVDVSDWAQREVERLSGAMVD--GERLNYLKIAVYHFSSSSPNGQGCAAHGSNDRQATEAALQRLQhELREAIDR 273 Nitrobacter ha...
Q31HD6        212 VMFDVSESVRNWVFIEHTRFRDGQPNLADEPTRYLKIAVYHFSKADPTHQGCAAHGSDDHKAAQAALQKLK-DFKQAIEN 290 Hydrogenovibri...
WP_012971924  199 ALFDVEEALDRWSSVELGRFREGVPNTADAPTRYLKVVVYHYSSRDPEHHGCAAHGSDTRQAAAAGRERLH-AFREAVEN 277 Allochromatium...
2FGY_A        309 AHCCGASIDILLIGVDTDTDAIRVHIPDSKGFLNPYRYVDNTVTYAQTLHLAPDEARVIIHEAILNANRSDGWAKgngvA 388
Q3SFK7        291 GFCCGASVATLLIGVDTDTDAIRVHVPDADGAMRTDCAVDNLAVYRQTAGMAASEARWRLDTAIDEAAREHGRSA----P 366 Thiobacillus d...
WP_015797596  279 SFFCGASIDLLLIGVDTDTDAIRVHVPDALGDMDLDRYVDNLDLYRQTIDDDVTTARMRVHRAIEAASADHPGGP----P 354 Acidimicrobium...
CAS:Atc_0929  292 AFCCGASTDLLLIGVDTDTDAIRIHIPDAHGDLSPHRYVDNAELYRHTLGLDADQARLAVYEAIRAASASDGWGKgegmP 371 Acidithiobacil...
jgi:Tgr7_3200 285 TYSCGASVDTLLIGVDTDTDAIKVHVPDADTRMSLYRYVDCGELYRETLEMDAQSASLRVYEAIQEAINTQGWGKgngpP 364 Thioalkalivibr...
jgi:TK90_0861 257 TYCCGASVDTLLIGVDTDTDAVKIHIPDADTRMSLYRFVDSAKVYRETQELDGREAELRVYQSIQDAIHQQGWGHgngaP 336 Thioalkalivibr...
WP_013121930  284 TYGVGAAPDILLVGLDTDVDALRIHLPDADGDVNPYRYVDTAELYRETVGLTAQAARAHIAQRVDEAQNMDGWAQgrgvM 363 Thiomonas inte...
Q1QFR7        274 TFGAGAAPDVLLIGVDTDLDALRIHLPDGFGEVNPHRYFETAQIYRDTVGLSPEAARARIAEIVADAEGMGGWGQgngsM 353 Nitrobacter ha...
Q31HD6        291 RFGCGSTVQTLLLGLNTDDDSMKVHIPNASGEVCLDRYVETEQLYQATMNLPDSEAKQALENAIVTCNQALGSTA----P 366 Hydrogenovibri...
WP_012971924  278 SYCCGASIEGLLVGIDTDTDRLRLHLPDARGDADLDRFVDAGALHRETARLDPEAARALIRERVANPSGGGLA------P 351 Allochromatium...
2FGY_A        389 SEGMRRFIGQLLINNLSQIDYVVNRHGGRYPpnDIGHAERYISVGDGFDEVQIRNLAYYAHLDTVEENAIDVDVGI-TIF 467
Q3SFK7        367 ESGMRRLIERLLTNNLSQIDYVCAQHNGRYA--DIGHAERFINIGDGFDEVFLRNLAYFGHLHTIEEGAADMDVGV-KIF 443 Thiobacillus d...
WP_015797596  355 HEGMRRLIATLLINNLSQIDYVRSTWGERYP--DVGHAEAFISVGDGFEEFQVRNLAYFVFLQTVEEAATDLDVGI-GLF 431 Acidimicrobium...
CAS:Atc_0929  372 HDGMRRLIATLLINNMSQIEYVGEYYGGWYG--DGGHAERFIGVGNGFQEVQVRNLAYYAHVDTVEEGAADLDVGI-KIF 448 Acidithiobacil...
jgi:Tgr7_3200 365 HEGMLRLVSRLLLNNISQLDYVARYHGGRYA--DVGHQERMIIVGDHFSEMQVRNFAYFTHLDTMEEGAKNMDVAVnQIF 442 Thioalkalivibr...
jgi:TK90_0861 337 HEGMLRLISRLLLNNISQLDYVARYHNGHYA--DVGHRERVIIVGQEVEEMQVRNFAYFAHLETMEEGAHGMDVGVnKIF 414 Thioalkalivibr...
WP_013121930  364 IPGMRQLVLALAEANLSQIEYVIHHHQGRYT--VLGHDEEFICAGEATQYVQMRNKYYFAHLDTVEEGAADVDVGI-KIF 440 Thiomonas inte...
Q1QFR7        354 REGMRRLVLALAEANLSQIEYVIKHHTGRYA--TIGHDEECIVAGEAVRVLQLRNLFYFAHLDTIEEGTNDMDVGI-NIF 430 Nitrobacter ha...
Q31HD6        367 QPELVKLLSWLIGNNFSQIAYVNQYENGCYS--DIGHAERFIGIGNGFEEVQLRNLSYYSFLDTVEEGVNDVDVGI-KIF 443 Hydrogenovibri...
WP_012971924  352 APGMQRLIARLIEHNISQLDYVRDYHNGHYT--DIGHEERFIGVGMDFAEIHLRNLTYFSFLRTLEEGACNLDVGI-KIF 428 Allochromatium...
2FGY_A        468 TKLNLSRGLPIPIAIHYRYDPNVPGSRERTVVKARRIYNAIKERFSSLDEQNLLQFRLSVQAQDIGSPIEEVA 540
Q3SFK7        444 SGLNVARGLPIPIAIHYRYDAQVPGSRERAVARCRRVKAAIETRYPHLAKEGLLYCGMTVQGKGPGSAHEAVT 516 Thiobacillus denitrif...
WP_015797596  432 QRRPERRGLPIPIAIHFRYDRRVPGSRERAIERCVRVRSAIRARYRDLCAAGLLACDMSIQERTFSSPIEVIE 504 Acidimicrobium ferroo...
CAS:Atc_0929  449 RKLNLEKGLPIPMALRYRFDSRVPGSRERVERKVQRMAAALRNRYASLVETDRLILWGGIQDLPLGSPMEEVD 521 Acidithiobacillus cal...
jgi:Tgr7_3200 443 RPLNISRGLPIPVVVHYRYNRNVPGSRERVEAHCRRVKAAIMERFRDLAEKSLIGCHMVIRDKKSGSRLELLe 515 Thioalkalivibrio sulf...
jgi:TK90_0861 415 RQLNVERGLPVPVVIHYRYDRKVPGSRERVEARCRRIRDQIMARYRELAEKGLIGCHMVIRDKRSGSQLEPla 487 Thioalkalivibrio sp. ...
WP_013121930  441 TGLNVRHGLSVPVLVHFYYSSRVPGSRERALNRAKQVKAAIEARYPALVARELLTCRMALSDRFDTERCVFVD 513 Thiomonas intermedia
Q1QFR7        431 RKLNIAHGLPVPVLVHFEYDARIPEARERAIARGRRVRDAIQARYSDLVAPGLLNCAIAVSDRTGGECCAFVT 503 Nitrobacter hamburgen...
Q31HD6        444 KGLNVKKGLPIPIIIRCDYDGRVPGSKDRAEAKALRIEKALHNRYQELSAPGLLQTLPTLRDFTSCKPAERLP 516 Hydrogenovibrio cruno...
WP_012971924  429 KQLNVDHGLPVPIVIRFEYSGQVPGARERAIERCERLAEAITQRYPDLAEHGLLHTYWTVRDSQGHGRLEPVG 501 Allochromatium vinosum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap