Conserved Protein Domain Family
Rb_C

?
pfam08934: Rb_C 
Rb C-terminal domain
The Rb C-terminal domain is required for high-affinity binding to E2F-DP complexes and for maximal repression of E2F-responsive promoters, thereby acting as a growth suppressor by blocking the G1-S transition of the cell cycle. This domain has a strand-loop-helix structure, which directly interacts with both E2F1 and DP1, followed by a tail segment that lacks regular secondary structure.
Statistics
?
PSSM-Id: 401034
View PSSM: pfam08934
Aligned: 6 rows
Threshold Bit Score: 275.665
Threshold Setting Gi: 1249005312
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002720769 767 ILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGG-NIYISPLKSPYkiseglPTPTKMTPRSRILVSIGESFGTSEKFQ 845  rabbit
XP_015197395 772 ILQYASPRPPTLSPIPHIPCSPYKFSNSPLRVPGSnNVYVSPLKSAR------MSPSVMTPRSRILVSIGESFGTSEKFQ 845  spotted gar
XP_017946619 707 ILQYGSARHPTLSPIPHIPRSPYRFGNSP-KVPG--NIYVSPLKTPYkttdglLSPSKMTPKTSFLISLGETFRSPDRFQ 783  tropical clawe...
XP_004076525 763 ilqyastrPPTLSPIPQIPCSPYKFPNSPLRVPGSnNVYISPLKNSR------LSPGMMTPRSRMLVSIGESFGFANRFQ 836  Japanese medaka
TNM85012     418 ilqyastrpptlSPIPQIPRSPYKFPNSPLRVPVSsNVYISPMKSPR------MSPGMMTPRSRMLVSIGEPFGLINRFQ 491  Takifugu bimac...
XP_022531737 758 ILQYSSPRPPPLSPIPHIPRSPYKYPSSPLRVPGG-NVYISPLKSNR------LTQAAMTPRSRFLVSIGESFGTSDKFQ 830  Mexican tetra
XP_002720769 846 KINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGTDEADG---SKHiPGESKFQQKLAEMTSTRTRMQKQKMNDNMDTS 922  rabbit
XP_015197395 846 RINQMVSSSDWSLKRGLESNSAPKPLKRLRFDTDGQDEADG---SKS-AGESKFQQKLAEMTSTRTRMQEQKLKDAAVDS 921  spotted gar
XP_017946619 784 KINQMLNSCERPIKRCADTGAAPKPLKKLRFDTDGQDEADG---SKHiSEESKFHQKLAEMTSTRTRMQKQKLEESLESP 860  tropical clawe...
XP_004076525 837 KINQMVNSGDRAHKRTLDGGSALKPLKRLRFDVDGQDEADG---SKS-GGESALIQKLAEMSSTRSRMQEQKMKEDAESR 912  Japanese medaka
TNM85012     492 KINQMVNSGDRSFKRSLDLGSTPKPLKRLRFDMDGQDEADG---SKS-GGDSTLIQKLTEMTSTRSRMQEQKMKEdaesr 567  Takifugu bimac...
XP_022531737 831 KINQMVSSTDWSLKRRLDGDATPKPLKKLRFDVDGQDEADGsksS----CESTMIQKLAEITSTRSRMQEQKLKEEAEKD 906  Mexican tetra
XP_002720769 923 NK 924  rabbit
XP_015197395 922 LK 923  spotted gar
XP_017946619 861 QK 862  tropical clawed frog
XP_004076525 913 KK 914  Japanese medaka
TNM85012     568 re 569  Takifugu bimaculatus
XP_022531737 907 Np 908  Mexican tetra
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap