Conserved Protein Domain Family
DUF1908

?
pfam08926: DUF1908 
Domain of unknown function (DUF1908)
This domain is found in a set of hypothetical/structural eukaryotic proteins.
Statistics
?
PSSM-Id: 401031
View PSSM: pfam08926
Aligned: 21 rows
Threshold Bit Score: 379.028
Threshold Setting Gi: 1022981283
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ETN63604      383 PIDSPRINSPSi-mQFPFqMPIKRIASTAAsKscDSRRWSVASLPSSGYVT-TPGSSNISSQCSSQERLHQFPAV--PTN 458  Anopheles dar...
XP_001957379  361 PVDSPRLNSPM---PFAF-APIKRIASCRGvV--DGRRWSVASLPSSGYGT-TPGSSNLSSQCSSQEGLNQLSHNipPGV 433  Drosophila an...
Q2M1D0        349 PVDSPRLNSPM---PFAF-APIKRIASCRGvV--DGRRWSVASLPSSGYGT-TPGSSNLSSQCSSQEALNQLPHNipPCV 421  Drosophila ps...
XP_972656     113 PIDSPRTHNSFi--NFPF-APIKRIVAGCRg---DGRRWSVASLPSSGYGT-TPGSSNMSSKCSSQERLHQLPHV--PTS 183  red flour beetle
EFX76338       65 PMESPRNMSPSq--QFAF-VPIKKA---------ECRRWSVASLPSSGYGT-TPASSNVSSQCSSQERLNHLPTV--PTA 129  common water ...
XP_002427035  112 PLESPRM-SPSm-gHFSF-VSLKRG---------DGRRWSVASLPSSGYGT-TPGSSDVSSQCSSQERLHQLPSV--PTV 176  human body louse
Q176L3        375 PIDSPRINSPSm-iHFPF-VPIKRITNKNS----DSRRWSVASLPSSGYVT-TPGSSNISSQCSSQERLHQFPPV--PTN 445  yellow fever ...
XP_563913     385 PIDSPRINSPSi-mQFPF-MPIKRIASTAAsKscDSRRWSVASLPSSGYVT-TPGSSNISSQCSSQERLHQFPAV--PTN 459  Anopheles gam...
OBS74026        6 PLDSPRNFSPNtpaHFSF-ASSRRA---------DGRRWSLASLPSSGYGTnTP-SSTVS------ERLHQLPYQ--PTV 66   desert woodrat
XP_029348704  101 PLESPKVVHSHp--HFPF-VSIKRPYNLLTtDcrDGRRWSVASLPSSGYGT-TSGSSNVSSQCSSQERLHQLPNM--PTS 174  pea aphid
ETN63604      459 DDL------------QLLSLHF---------------------------------------------------------- 468  Anopheles dar...
XP_001957379  434 QEAdaaavaagaccaEHLKQHCpkhcalllavvhqkqqqtpqlqqqppkpsqlqpqklmpascvnccaelssacsaggqh 513  Drosophila an...
Q2M1D0        422 QDAdaaavaagaccaEHLKQHCprhcvllqaaaqkqpqqpqlhkqpktsqlqp-------qkltvagcinccadlsiacs 494  Drosophila ps...
XP_972656     184 DDM------------RILTHHF---------------------------------------------------------- 193  red flour beetle
EFX76338      130 EEM------------RILSRHF---------------------------------------------------------- 139  common water ...
XP_002427035  177 DEL------------QMLSQHF---------------------------------------------------------- 186  human body louse
Q176L3        446 DDL------------QMLSLHF---------------------------------------------------------- 455  yellow fever ...
XP_563913     460 DDL------------QLLSLHF---------------------------------------------------------- 469  Anopheles gam...
OBS74026       67 DEL------------HFLSKHF---------------------------------------------------------- 76   desert woodrat
XP_029348704  175 DEL------------HMFSKHF---------------------------------------------------------- 184  pea aphid
ETN63604      469 -----------SSNDSNPSLgemrshaaqygahhhghhyghhhqhhhhhhhnlphhplatshhhpshhgglqqqqqhhhh 537  Anopheles dar...
XP_001957379  514 avggggtpaagSTSNAVPGA------------------------------------------------------------ 533  Drosophila an...
Q2M1D0        495 gkgqdkdnstcSASNSTPGQggv--------------------------------------------------------- 517  Drosophila ps...
XP_972656     194 -----------SSNESNPSLptgny------------------------------------------------------- 207  red flour beetle
EFX76338      140 -----------SSNESNPVIeetdg------------------------------------------------------- 153  common water ...
XP_002427035  187 -----------SSNDHGEEE------------------------------------------------------------ 195  human body louse
Q176L3        456 -----------SSNDSNPSMegrnlhhhhgfhhlhhhhphqhsgsgfnppvsplapqy---------------------- 502  yellow fever ...
XP_563913     470 -----------SSNDSNPGLgearthhshlhhhhlhhhqhhggtiyhqqplslqahvgygpgpta--------------- 523  Anopheles gam...
OBS74026       77 -----------GSTESITDEd----------------------------------------------------------- 86   desert woodrat
XP_029348704  185 -----------SSNDSTHSAeed--------------------------------------------------------- 196  pea aphid
ETN63604      538 hslpagagthyasasyqhplsvagpggasispqapgsilyqqqqtqqqplslphqtspamksvgssgsgscnataaaaaa 617  Anopheles dar...
XP_001957379      --------------------------------------------------------------------------------      Drosophila an...
Q2M1D0            --------------------------------------------------------------------------------      Drosophila ps...
XP_972656         --------------------------------------------------------------------------------      red flour beetle
EFX76338          --------------------------------------------------------------------------------      common water ...
XP_002427035      --------------------------------------------------------------------------------      human body louse
Q176L3        503 ----------------------------------------------------------qhstqqplslqshathcnsphs 524  yellow fever ...
XP_563913     524 ---------------------------------------------------ptglqlashqqhcalkssvgssgsgscgs 552  Anopheles gam...
OBS74026          --------------------------------------------------------------------------------      desert woodrat
XP_029348704      --------------------------------------------------------------------------------      pea aphid
ETN63604      618 atgtpgardeqnnfcGCRSPIHRPRSRSLsS-PSHSPI-TDNEISIMNTFYKERFPKATQQMEERLSHFINENKTILNDS 695  Anopheles dar...
XP_001957379  534 ---------------GRMSPYFRPRSRSLsS-PSRSPI-VDNEIAVMNTLYKERFPKATQQMEERLKHFINENKSAACNS 596  Drosophila an...
Q2M1D0        518 -------------apGRLSPHFRPRSRSLsS-PSRSPI-VDSEIAVMNTLYKERFPKATQQMEERLKHFIHENKSAACSS 582  Drosophila ps...
XP_972656     208 ----------eenpiSHRSPLHRPRSRSLsS-PSRSPV-MDNEICMMNVLYKERFPKATQQMEERLNHYIEENKTFDFGE 275  red flour beetle
EFX76338      154 -----------aaaaGRHSPRMRPRSRSL-S-PIRSPV-VDSEVVMMNMLYKERFPKATRQMEERLKTFVEENASVESSE 219  common water ...
XP_002427035  196 ---------------GRRSPRFRPRSRSLsS-PSRLPV-FDNDIVLMNTLYKERFPKATQQMEEKLKSFIIENTSEAHCD 258  human body louse
Q176L3        525 vkssgsckdelnnfcGCRSPIHRPRSRSLsS-PSHSPI-TDNEISLMNTFYKERFPKATQQMEERLSHFINENKNIINDS 602  yellow fever ...
XP_563913     553 ggpptstkdelnnfcGCRSPIHRPRSRSLsS-PSHSPI-TDSEISIMNTFYKERFPKATQQMEERLSHFINENKTIVHDS 630  Anopheles gam...
OBS74026       87 --------------gGRRSPAVRPRSRSL-S-PGRSPSsYDNEIVMMNHVYKERFPKATAQMEEKLRDFARAYEPDSVLP 150  desert woodrat
XP_029348704  197 ------------niiYRKPRFNRPRSRSL-SsPSRSPV-LDNDIVMMNVLYKDRFPKATHQMEERLSMFINEYEKLSLEH 262  pea aphid
ETN63604      696 Tr-------------nSQPIVRFVHHQVLEMARDCLHKSHAKLITSRYFYEMSDNLERLLMETKEKS-PEAAPEITGVIK 761  Anopheles dar...
XP_001957379  597 Fr-------------dSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKEKS-PEAAAELSGVIK 662  Drosophila an...
Q2M1D0        583 Fr-------------dSQPIVRFVHHQVLEMARDCLHKSEAKLITSQYFYELSENLERLLVETKEKS-PEAAAELSGVIK 648  Drosophila ps...
XP_972656     276 Dc-------------dYLPIVRFVHHQVLEMARDCLHKSQSKLITSRYFYEMSENLERLLTETKDKS-EEAANLVTGFIK 341  red flour beetle
EFX76338      220 AlvaaaegssepipadAIAIVRFVQHQVIELGRDCLQKSEQGLITSRYFYDMSDNLEKLLNEAKDKA-VDAVPHLSRLVR 298  common water ...
XP_002427035  259 Ifdnv--------sqdSVPIIRFVHHQIIEMARDCLQKSQEKLITSLYFYEMTENLEILLTETKEKS-PQAASKITG--- 326  human body louse
Q176L3        603 Ar-------------iSQPIVRFVHHQVLEMARDCLHKSHAKLITSRYFYEMSENLERLLLETKEKS-PEAAPEITAVIK 668  yellow fever ...
XP_563913     631 Ar-------------nSQPIVRFVHHQVLEMARDCLHKSHAKLITSRYFYEMSENLERLLMETREKS-PEAAPEITGVIK 696  Anopheles gam...
OBS74026      151 L---------------ADGVLSFIHHQIIELARDCLTKSRDGLITTVYFYELQENLEKLLQDAyERSeSLEVAFVTQLVK 215  desert woodrat
XP_029348704  263 Ieis----------adAVPIVRFVNHQVLEIARDCLKKSEEKLITRGYFYEMSENLELLLAEAREKS-EEATALLTGTMK 331  pea aphid
ETN63604      762 KLLLIISRPARLLECLEFDPEEFYRLLEVAEGQAKVTQGIKADIPQYIIQKLGLNRDPIAE 822  Anopheles darlingi
XP_001957379  663 KLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQYIIHKLGLNRDPIAE 723  Drosophila ananassae
Q2M1D0        649 KLLLIISRPARLLECLEFDPQEFYELLEAAEGHAKAMPVIKADIPQYIIHKLGLNRDPIAE 709  Drosophila pseudoobscura
XP_972656     342 KLLLIISRPARLLECLEFDPEEFYHFLEAAEGQVKVVQGIKADIPQYIIQKLGLNRDPIAE 402  red flour beetle
EFX76338      299 KLLLIISRPARLLECLEFDPEEFYHMLEEAEGQVKTTQGV-TDFPQYIVTQLGLNRDPLAE 358  common water flea
XP_002427035  327 --------PARLLECLEFNPEEFYRILEKVEGHAKSNQGIKDDLPQYIVGKLGLNRDPIAE 379  human body louse
Q176L3        669 KLLLIISRPARLLECLEFDPEEFYRLLEVAEGQAKVTQGIKADIPQYIIQKLGLNRDPIAE 729  yellow fever mosquito
XP_563913     697 KLLLIISRPARLLECLEFDPEEFYRLLEVAEGQAKVTQGIKADIPQYIIQKLGLNRDPIAE 757  Anopheles gambiae str. PEST
OBS74026      216 KLLIIISRPARLLECLEFNPEEFYHLLEAAEGHAKEGHLVKTDIPRYIIRQLGLTRDPFPg 276  desert woodrat
XP_029348704  332 KLLLIISRPARLLECLEFDPEEFYHLLEQAEGQAKICQGIKDEIPQYIIGKLGLTRNSVDD 392  pea aphid
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap