Conserved Protein Domain Family
PhoQ_Sensor

?
pfam08918: PhoQ_Sensor 
PhoQ Sensor
The PhoQ Sensor is required for the virulence of various Gram-negative bacteria by allowing interaction of PhoPQ with the intracellular membrane, resulting in remodelling of the bacterial cell surface and subsequent bacterial resistance to host antimicrobial peptides. The domain contains a major flat acidic surface, which binds to at least 3 calcium ions, neutralising the domain's negative charge and allowing interaction with the negatively charged membrane.
Statistics
?
PSSM-Id: 401024
View PSSM: pfam08918
Aligned: 16 rows
Threshold Bit Score: 284.946
Threshold Setting Gi: 289175157
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7N3B1            8 PFSLRTRFLMATAAVILALTMSYGIVAIVGYLVSFDKTAYTLLRSQSNLFFSLAQWNNNQLDISVPPNFTLNNPSLVLIY 87  Photorhabdus...
CAX59218          9 PFSLRARFLVATAAVVLILSLSYGMVAVVGYVMSFDKNTYRVMRGESNLFFTLAQWQDGKLTIAQPERVSLNFPTLVYIY 88  Erwinia bill...
WP_010617223      9 PFSLRARFLLATAAIVLFLSLSYGMVAVIGYVVSFDKNTYRVMRGESNLFFTLAQWKDNKLTIAQPERMTLNFPTLVFIY 88  Plautia stal...
WP_015871615     13 PLSLRTRFMLATAAMVFLLSLAYGLVAVVGYAVSFDKTTYRLLRGESNLFFSLAHWQDGRLTITPPPNMALNTPTLVMIY 92  Edwardsiella...
CBJ90764          8 nVSLRTRFLMATIVIILALTLSYGIVAIAGYLVSFDKTNYSILRNQSDLFFMLTKWDNNKLKVLVPKNFSMNSRSLALIY 87  Xenorhabdus ...
CBJ81960          1 ---------MATSAIILALTLSYGLVAIIGYLVSFDKTIYSILRSQSNLFSTLAKWDGSKLVIKIPPNLSMTNRSLALIY 71  Xenorhabdus ...
WP_004238109      8 PFSLRTRFLLATFAVILAMTLSYGAVALVGYLVSFDKTTYTMLRSQSNLFYSLSQWDDGKLNIRFPPNFSLNAPSVVLIY 87  Morganella m...
WP_002440279     10 PLSLRVRFLLATAAVVLVLSLAYGVVALLGYSVSFDKTTFRLLRGESNLFYTLARWEDGKITLDVPEHLDLQSPTLTFIY 89  Shimwellia b...
WP_004147969     10 PLSLRVRFLLATAGVVLVLSLAYGMVALVGYSVSFDKTTFRLLRGESNLFYMLARWENGAIDVDIPENLNMESPTVTLIY 89  Enterobacter...
wugsc:CKO_01923  10 PLSLRLRFLLATAGVVLVLSLAYGMVALVGYSVSFDKTTFRLLRGESNLFYTLASWQNNKINIEIPENLDMQSPTMTLIY 89  Citrobacter ...
Q7N3B1           88 NNKGAILWRQHHIPKVENSIPSEWLKEDGLYELDTDLKSSRDLL-KNSANTQGQLGKLNsldENEDNELTHSVSVNRYSA 166 Photorhabdus...
CAX59218         89 NEKGKLLWQLRDVPEIRNKIKREWLKSSDFYEIDTDNSTSREAL-GNNTEAQNKLTAYD---DDNNDTFTHSVAVNRYDA 164 Erwinia bill...
WP_010617223     89 DERGKLLWQQRDMPEIRKNIRRDWLMKPDFYEIDTSNRTSMAAM-GNNPQAQQRLHALD---SDSNDTFTHSVAVNRYDA 164 Plautia stal...
WP_015871615     93 DREGRLLWSKRQIPALEKRIERSWLEKPGFYEIDSNKYFSSTVL-GDNPRMQNQLKDYD---DDSADAMTHSVAVSQYTA 168 Edwardsiella...
CBJ90764         88 DNEGNILWRQNNVPELEKMIDPNWLKKNGLYELEVYFKEKDDLI-YNKALNQKDTKKTE---GDNHVLLTYSVAVNIYSA 163 Xenorhabdus ...
CBJ81960         72 DNQGRILWRQSYTPELEKKIPGEWLKKDGLHDLSISFKDKEGFLyPKTPTQSDNSTKTNw--SDNNELLTYSVAVNSYAK 149 Xenorhabdus ...
WP_004238109     88 DDNQNLLWRQYHIDALERAIPAKWLTKEGLYDLNTSLEATKSLL-VNTPLFATEDIRINdldDDHDGRMIHSVSVSRYGK 166 Morganella m...
WP_002440279     90 DEHGKLLWSQRQVPWLEKHIKPEWLKSNGFHELEASYASSRVLV-GNNHAVQRKLSDIHd--DDSDEELTHSIAVNRYPA 166 Shimwellia b...
WP_004147969     90 DEQGKLLWAQRDVPWLAKRIQPEWLKRNGFHEIEADVDSSSMLL-RNNHEIQEQLDAIRe--QGDDSEMTHSVAINLYPA 166 Enterobacter...
wugsc:CKO_01923  90 DENGKLLWAQRNVPWLEKRIQPEWLKANGFHEIEADVDATSTLL-SEDHSAQQQLKEVRe--DDDDAEMTHSVAVNVYPA 166 Citrobacter ...
Q7N3B1          167 TAHLPALTIVVIDTIPQDLQKTV 189 Photorhabdus laumondii subsp. laumondii
CAX59218        165 TPNLPALTIVVVDTIPQELQHSD 187 Erwinia billingiae Eb661
WP_010617223    165 TTNLPALTIVVVDSIPQELQHSD 187 Plautia stali symbiont
WP_015871615    169 TAHLPALTIVVVDTIPQELQNSD 191 Edwardsiella ictaluri
CBJ90764        164 TETLPAMTIVIIDTIPQDVQESs 186 Xenorhabdus nematophila ATCC 19061
CBJ81960        150 TDKLPAMTIVIIDTIPQDMQSSv 172 Xenorhabdus bovienii SS-2004
WP_004238109    167 TDTLPPLTIVVVDTIPQNLQKTf 189 Morganella morganii
WP_002440279    167 TGIMPALTMVVVDKIPIELKRSY 189 Shimwellia blattae
WP_004147969    167 TSKMPQLSIVVVDTIPVELKRSY 189 Enterobacteriaceae
wugsc:CKO_01923 167 TARMPQLTIVVVDTIPIELKRSY 189 Citrobacter koseri ATCC BAA-895
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap