1KS6


Conserved Protein Domain Family
ecTbetaR2

?
pfam08917: ecTbetaR2 
Click on image for an interactive view with Cn3D
Transforming growth factor beta receptor 2 ectodomain
The Transforming growth factor beta receptor 2 ectodomain is a compact fold consisting of nine beta-strands and a single helix stabilized by a network of six intra strand disulphide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets (beta1-beta4, beta3-beta9).
Statistics
?
PSSM-Id: 401023
View PSSM: pfam08917
Aligned: 20 rows
Threshold Bit Score: 130.111
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KS6_A         4 RLCKFCDVKATTCSNqDQCTSNCNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKD 83  chicken
XP_688938     28 NLCKWCDHSSPVCED-NVCMSNCSLTSYCFLAEEVCVAIWKKDNVSVSVRTLCYDPQHMLENIMLANYSSKECLMSPHPS 106 zebrafish
XP_015212522  36 LLCKFCDFEPSTCDGrSNCFSNCSKTAICEKPQEVCVSIWRKDDNNVTIETLCHDPAEKIYGLLLDDYNSTKCYMKEKKF 115 spotted gar
XP_007669245  45 GLCKFCDVESTICTNqGVCKSNCSITSICENTFDICAAVWRKNDENITLETICHDQRLPLHGFDLDDIGSSKCMMKEKKM 124 platypus
XP_012002509  49 QLCKFCDVRSSTCDNqKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASPKCIMKERKG 128 mouflon
P38438        49 QLCKFCDVTLSTCDNqKSCMSNCSVTSICEKPQEVCVAVWRKNDKNITLETVCHDPKFTYHGFTLEDATSPTCVMKEKKR 128 Norway rat
XP_002941621 207 vLCRFCDVKETTCENqGYCTSVCNIASVCEHQEEVCIAIWRNKDGNITEETMCHDPKKELYGYKLDDYNEKECIMKEKKT 286 tropical clawed...
XP_014342565  61 NLCLFCDLEPTNCEAqGSCKPTCNRTSICEDPQEVCIAIWRKKGTNVTIETVCHDPKKKLHGFDIEDFESNTCEMKEKKV 140 coelacanth
TNN34925       5 MLCKFCDVRATSCTGkASCKAECEITSICPNDEDVCVSTWRKKDDNFTIDTVCHNRSQKLHGLVLEDYNNSKCEMKEIKG 84  Tanaka's snailfish
CAG05723       5 KLCKFCDVRATSCTGiGSCTVGCEITSTCADKEEVCVSIWRKAGSNVTFDTVCHNPAYKLYGLVLDDYNNSKCEMKEIKG 84  spotted green p...
1KS6_A        84 DGGLMFMCSCTGE-ECNDVLIFSAI 107 chicken
XP_688938    107 EDGLLFICSCVGDqECNDRLIFDKG 131 zebrafish
XP_015212522 116 PGSLFYVCSCTEE-ECNNKLIFSPE 139 spotted gar
XP_007669245 125 LGETMFMCSCSSE-ECNDLLYFSEE 148 platypus
XP_012002509 129 SGETFFMCSCSAE-ECNDHIIFSEE 152 mouflon
P38438       129 AGETFFMCSCNTE-ECNDYIIFNEE 152 Norway rat
XP_002941621 287 SEGIMSMCSCRGK-LCTERFYFPPA 310 tropical clawed frog
XP_014342565 141 PDWQVYMCACLGE-ECNGDLIFTKM 164 coelacanth
TNN34925      85 MGSLFFICSCSED-ECNEHILFNsy 108 Tanaka's snailfish
CAG05723      85 MGSKFFICSCSTD-ECNEHIFFNPT 108 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap