1Q2H


Conserved Protein Domain Family
Phe_ZIP

?
pfam08916: Phe_ZIP 
Phenylalanine zipper
The phenylalanine zipper consists of aromatic side chains from ten phenylalanine residues that are stacked within a hydrophobic core. This zipper mediates dimerization of various proteins, such as APS, SH2-B and Lnk.
Statistics
?
PSSM-Id: 401022
View PSSM: pfam08916
Aligned: 35 rows
Threshold Bit Score: 61.4994
Threshold Setting Gi: 1032758429
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Q2H_A         6 DWRQFCELHAQAAAVDFAHKFCRFL-RDNPAYD-TPDAGASFSRHFAANFLDVFGEEV 61 
XP_004922750  11 GWVEYCEREARAAAQELAKGCLPYIqPGHEAAAqPPTTHKDLLKKFIDCFTEHFDIEI 68  domestic silkworm
OWR47836      11 GWVEMCERQAKTSAQDFAKACLQYIqTNSNEAAaRPLSQKELLKKFVECFSEQFDFEF 68  Danaus plexippus plexippus
XP_001999614  56 SLEEFCDRHARVAASDFAKACINYInSNLPPDVaRGISHRNFSIKFVEFFTVHYAAEF 113 Drosophila mojavensis
XP_001996236  57 TWEEFCDRHARVAASDFAKACITFInGSLPPEVaRNIPYHSFAAKYVEYFSQHYDTEF 114 Drosophila grimshawi
EDW45048      68 SWEEFCERHARVAASDFAKACITYInGNLPPEEaRNIQHRSFAQKFVESFSAHYDTEF 125 Drosophila sechellia
Q17DJ2        59 vWAEFCERHARAASADFARSCVHYItTNLPESArQTVSHRDFMRRFVDCFQEHFGHDF 116 yellow fever mosquito
ETN58674     101 tWTEFCERHARAASADFARACVNYVtSNLPEVArHTISHRDFMRRFVQCFEEHFEHDF 158 Anopheles darlingi
XP_972963     13 SWIEFCERHASVAAQDFSKSCVQFMsLNLSESAkATITHKDFLGKFLETFAEHFETDF 70  red flour beetle
EGI66176       2 GWIEFCERHARASASDFAKAFCAYVsLNLPESArANLSHRDFLRKFVESFCEHFESEY 59  Panamanian leafcutter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap