Conserved Protein Domain Family
DUF1852

?
pfam08908: DUF1852 
Domain of unknown function (DUF1852)
This family of proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 401016
View PSSM: pfam08908
Aligned: 25 rows
Threshold Bit Score: 610.843
Threshold Setting Gi: 502284842
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012751106              16 DDLTFSIHTTPFDEDYTPAASTRATTNFANLARGADRRENLRAALAMIDGRLNDLAPWDNPERDRYTARIEIVSIDVHFt 95  hig...
PRJNA212980:JCM7686_1415  60 TDLTYSLKSTRFDENYRPAENTRTTTNFANLARGSRREENLRNTFKMIDNRFNALAHWDNPGNDRYSVELEIISAEISIg 139 Par...
WP_011747674               3 KDLAYSIKSIRFDESYRPSDSTRATTNFANLARGSRRRENLRNAFTMIDNRFNALAHWDNPNSDRYSVELDIISAEIDIs 82  Par...
Q8PDL8                     3 QELTFSIKSLRFDEDYRPAANTRNTTNFANLARGQRRQENLRNTLAMINNRFNDLAHWDNPKRDRYAVELDIISVEMKIg 82  Xan...
BAJ76380                   3 NDITFSITTTRFDEHYAPAENSRVTTNFANLARGAGRRQNLRGALSMMDRRLNELLSTEA----RYRLELDIVSVQLQFs 78  Mic...
CBT74920                   3 DALNFSISTTRFDENYSPSTNSRTTTNFANLARGERREENLRNALTMINRRFNSLAHWDNPQGDRYSLELEIISANVHFs 82  Glu...
ADO43396                   3 SEFTFSLKSIRFDEDYHPATNTRATTNFANLARGAHRQENLRNALTMINNRFNALADWDNPDSDRYGLALDIISVEI--- 79  Ket...
jgi:Astex_0636            11 SDFDFTLRRLRFNEHYTPSQTTRLTTNFANLARGDTRQQNLRNALRMIDNRFNALAHWDNPNADRYAIELDIISVEIDLp 90  Ast...
jgi:Aave_2780              3 QELHFTLKSICFDEDYQPSDSTRITTNFANLARGANRRRNLRNTLRMIDNRFNDLAHWDNPAGDRYAVALEIVSVEMNId 82  Aci...
jgi:Daci_2549              3 AELHFSLKSIRFDENYHPSDSTRITTNFANLARGTSRQQNLRHTLRMIDNRFNELAHWDNPTGDRYSVELDIISVDMGMg 82  Del...
WP_012751106              96 aDDGADVdFPLMEMLDVRVVERATGAVLGRSVGNNFSSYVRDHDFSVVLPAHAATSPGTEEPDGFGDLHGRLFRHLLDSQ 175 hig...
PRJNA212980:JCM7686_1415 140 dNKSAEA-FPLIEILKPTILDRKNGQRIEGIAGNNFSSYVRDYDFSILLPQHNDGRSSFSAPAHFGDLHGNLFRFFLKSP 218 Par...
WP_011747674              83 dGSHVDA-FPLIEILKPTILDLKTGKRLAGIAGNNFSSYVRDYDFSVVLPQHNEGQPHFSTPDDFGDLHGNLFKCFLNSS 161 Par...
Q8PDL8                    83 eRDTGDA-FPLIEILQPSILDQTTGARIDGIAGNNFSSYVRDYDFSVLLPAHNQDTSSFSLPEGFGSLHGTLFKQFVNSD 161 Xan...
BAJ76380                  79 dGADDEQ-FPVIEVLDVHILDTETGESHPGIVGNNFSSYLRDYDFSVVLPAAKAAAGTFTVPEDFGDLHGQLFQHFLDSA 157 Mic...
CBT74920                  83 aDNTDKQ-FPLLEVLETTIVDKLTGTRSQGMVGNNFSSYVRDYDFSVVLPASCNDSGAPVLPEDFGDLHGQLFQHFLNSQ 161 Glu...
ADO43396                  80 -AGGADA-FPLIEILKTTIIDHHRNTRIDGIAGNNFSSYVRDYDFSVLLPTLKKRAPDAALPDTFGDLHGKLFQCFVNAP 157 Ket...
jgi:Astex_0636            91 dRATNDR-FPLLEILNTTILDRHTSSSIAGMTGNNLSSFVRDYDFSVVLPAHNRDRPDFSLPPNFGDLHGHLFLSFVRSP 169 Ast...
jgi:Aave_2780             83 aTGGNGT-FPLIEILKTSMFDRQANRRIDGIAGNNFSSYVRDYDFSVLLPDYNAGRAEFGTPDDFGDLHGKLFKQFVHSD 161 Aci...
jgi:Daci_2549             83 aEMGSGV-FPLIEILKTSILDRKSNKRIAGIAGNNFSSYVRDYDFSVLLPEYNINRQEFSTPDDFGDLHGKLFKQFARSS 161 Del...
WP_012751106             176 AYRDRFPQPPVICISVSTSRTYRRLTNEHPVLGVEYRQDEASRTDRYFGRMGLGIRCFLPRGAVAPLAFYSRGDLLNDHA 255 hig...
PRJNA212980:JCM7686_1415 219 AYKETFKKLPVICLSVSSSKTYQRTENTHPVLGVEYRQDAFSATDLYFEKMGLQVRYFMPPNSVAPLAFYFTGDLLSDYS 298 Par...
WP_011747674             162 VYKENFEKPPVICLSVSSSRTYHRTENGHPALGVEYRQDEFSSTDRYFEKMGLQVRYFMPPNSVAPLAFYFTGDLLNDYS 241 Par...
Q8PDL8                   162 TYTARFAKPPVICISVSSSKVYHRTGNRHPILGVEYRQDAFSLTDQYFEKMGLQVRYFMPPNSVAPLAFYFLGDLLNDYT 241 Xan...
BAJ76380                 158 TYRDRFPSSPVICISVSTSRTYHRTGVVHPVLGVEYEQDAFSLTDEYFAKMGLRVRYFMPRGSVAPLAFYFRGDLLADYT 237 Mic...
CBT74920                 162 AYRERFAQLPVICISVSTSKTYFRTGNSHPVLGLEYHQDENSLTDAYFGKMGLSVRYFMPPGAVAPLAFYFRGDLLNDYT 241 Glu...
ADO43396                 158 IYRDTFAKAPVICLSASSSRTYQRTDNWHPILGVEYRQDAPSLTDQYFAKMGLRVRFFMPKGSVAPLAFYCAGDVLGDYS 237 Ket...
jgi:Astex_0636           170 TYKAQFHKPPVICLSVANSKTYRRTNTYHPILGVEYEQNDESLTDIYFRKMGLTVRFFMPPGSVAPLAFYFFGDLLSDYT 249 Ast...
jgi:Aave_2780            162 TYRGQFTKPPVICISVSTSRTYRRTGNRHPVLGVEYLQDELSSTDRYFAKMGMQVRFFMPPGSVAPLAFYFHGDLPNDYT 241 Aci...
jgi:Daci_2549            162 TYREHFNKPPVICISASISKTYQRTGNQHPVLGAEYQQNELSSTDRYFGKMGMQVRFFMPPNSVAPLAFYFQGDLLADYT 241 Del...
WP_012751106             256 NLSLAGLIATMETFQRIYRPEIYNANAGAGEVYRPRLDHGDFSQTRIAYDREERARLGREQGEYTQEHFVGPHRDLLERW 335 hig...
PRJNA212980:JCM7686_1415 299 CLELIGTISTMETFQRIYRPEIYNANSIAGKTYQPSLKHQDYSLTQIAYDRDERSRLAIEQGQRARDTFIEPYREILEKW 378 Par...
WP_011747674             242 SLELIGTISTMETFQRIYRPEIYNANSPAGQCYRPSLKHGDYSLTQIVYDREERSRLAVEQGKFAYENFIKPYRDILEKW 321 Par...
Q8PDL8                   242 NLELIGTISTMETFQKIYRPEIYNANSAAGTIYQPSLKHQDYSATQIVYDRQERSQLAVTQGKFTQEHFIKPYGDILEQW 321 Xan...
BAJ76380                 238 DLQLAGTIATMETFQKIYRPEIYNAVVPAGEVYRPTLDQAEFVRTGIDYDREERSQLAVVQGRYAEEHFVKPHRAALDAW 317 Mic...
CBT74920                 242 NLQLISLISTMETFQKIYRPEIYNANSAAPSVYHPSLGAEDFSPTRVFYDREERTQLGKIQGKFTEEHFIIPNRQLLDQW 321 Glu...
ADO43396                 238 NLELIGTISTMETFQKIYRPEIYNANAAAGKVYQPSLTHRDYATTQITYDRDERSRLGIAQGKFAEEHFIKPNQFTLAQW 317 Ket...
jgi:Astex_0636           250 SLELISTISTMESFQKIYRPEIYNANAAAGAVYQPSLQHPDYSLTQVVYDREERSRLAVEQGRFAEAHFITPYRTLLEQW 329 Ast...
jgi:Aave_2780            242 NLELIGTISTMETFQKIYRPEIYNANSAAGAIYRPSLEHQDYSLTQIVYDRVERSQLAVKQGKFAEEHFIKPYRNVLDRW 321 Aci...
jgi:Daci_2549            242 NLELIGTISTMETFQKIYRPEIYNANCAAGKIYQPSLKNHDYSLTQIVYDREERSQLAIKQGRFAQEHFIKPYRNVLEQW 321 Del...
WP_012751106             336 AA 337 high G+C Gram-positive bacteria
PRJNA212980:JCM7686_1415 379 SS 380 Paracoccus aminophilus JCM 7686
WP_011747674             322 SA 323 Paracoccus denitrificans
Q8PDL8                   322 AS 323 Xanthomonas campestris pv. campestris
BAJ76380                 318 SA 319 Microbacterium testaceum StLB037
CBT74920                 322 SS 323 Glutamicibacter arilaitensis Re117
ADO43396                 318 SA 319 Ketogulonicigenium vulgare Y25
jgi:Astex_0636           330 SA 331 Asticcacaulis excentricus CB 48
jgi:Aave_2780            322 AA 323 Acidovorax citrulli AAC00-1
jgi:Daci_2549            322 AA 323 Delftia acidovorans SPH-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap