Conserved Protein Domain Family
DUF1849

?
pfam08904: DUF1849 
Domain of unknown function (DUF1849)
This family of proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 401012
View PSSM: pfam08904
Aligned: 41 rows
Threshold Bit Score: 252.559
Threshold Setting Gi: 501558638
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
goetting:OCA5_c22360  28 AAPAMGLMAHEASYELSLAKARGNAaVSSANGRILYKFGGNvCEGYSTDFRQVSRIEAGEDRATTSEMRSSNWEDGQGKK 107 Oligotr...
WP_013045493          25 pglaGAVVAHRAFYEMTIGEMNKNSsVLSVSGRSAYSVERD-CDGWRSVEDYVIEFGGAGGNVQRILSHFESWEADAGDK 103 Candida...
QianUST:TMO_2564      54 ALAAPHSVPHRAHYAMSLLKAQPDAaIAGVAGDMAVIFDRA-CDGWSVLQASRMEIDFDEAEPVVSDILFDSEESDDGTR 132 Tistrel...
ACI98939              42 gAAASQVVPHLATYKLSLASSRSSAtVTGVDGAMSYAWKDA-CDGWTVEQRFQVRFTYVEGEQVELSTSYVTWEAKDGSA 120 Rhodosp...
WP_014248105          41 AAVAAKIQPHRAIYAMSLGSARNGSkVSDVRGRMMFEWADA-CDGWTTEQRFQLRFVYSEGDDMAMNTNYTTWEAKNGLR 119 Azospir...
CCC99953              52 AGAAANILPHRAVYKMSLLSARNSSkVSDVRGRMLFEWADA-CDGWTTEQRFQLRFVYAEGDEMAMTTNYTTWEAKDGQR 130 Azospir...
IGS:MICA_1957         65 KDEMASIVPHKAIYNIEMVERRSGSqVLNISGQMYFELKKT-CDAWISDHRFNMLYEYADTPPMRITSDFATYEQLDGDT 143 Micavib...
Q2RSM6                28 QAAGPTLAPHEAVYALSLARATPGG-VVNARGEMNYKLENT-CAGWTMETRTTLDLTYAEGGEMATQWEFVAYESKDGGD 105 Rhodosp...
CDK99274              21 LAGPADLAPHRAVYSMGLSTTKPGSgIAAASGTMSYQFEDT-CDGWVVENRIAITYAYTEGGQALSATDFITWESKDGLH 99  Magneto...
Q2W3D9                23 VAAAADLASHRATYRMGLSASRSGSgMANASGAWTYQFIDA-CDGWITEFQLVITYAYSEGGQVATTTDFLGWESKDGLH 101 Magneto...
goetting:OCA5_c22360 108 YRFNVVNQTNDDAPVLVNGTAERGSDGt-ITVKLKQPQAKTFTLDKEIVFPTEQTRRIIAAAKEGRRFVELGVYDGSDNg 186 Oligotr...
WP_013045493         104 YSFDIEEKSTFEGDKQFGGFAQMTEQG--GDAVFTNELNDKIVLPSDTYFPMQHVEEIIESANAGTRIIAASVFTGAEPe 181 Candida...
QianUST:TMO_2564     133 FRFRYEERENGESVELAIAHLDRTSPDrpSKLRFANPPGVTESVPAGALLPTAHTERLLQAAEAGEAFIRAQVLTGSGQ- 211 Tistrel...
ACI98939             121 YRFNVRKLTNGELEEELRGDATLNGADg-GVARFERPDRKELALRPGTLFPTAHTIRMLDLARKGDNFLSAPIFDGSEA- 198 Rhodosp...
WP_014248105         120 YRFNVRKLVNGELDEEVRGEANLQADGa-GSAQFTKPEPQEMELPAGTMFPTAHTLAILDHAERNEPFFTRTIFDGSDA- 197 Azospir...
CCC99953             131 YRFNVRKLINGEEDEEVRGDARLAKDGt-GTAAFSKPEPQDMELPPNTMFPTAHTLAVLDHAGAGETFFNRVVFDGADS- 208 Azospir...
IGS:MICA_1957        144 FDFTSRRRRDGTVFQELRGRATVDSKG--GKAEFSKPDGLDYRLSPDILFPMGHTLATLKAARDGKTFLTLPMFDGSDE- 220 Micavib...
Q2RSM6               106 YSFFVRNKRNGEVDEVLEGSAALAGQPpkGEASFHKPENDVVPLPAGTLFPSAHTLDILRAAERGERYLSRTVFDGASE- 184 Rhodosp...
CDK99274             100 YRFRMRNTRDGQVTEDVEGHADLKGKGqgGTARFSRPEPMTLALPKGTLFPTEHTLRLIDHAQSGGRSFWRVVFDGSGL- 178 Magneto...
Q2W3D9               102 YRFRVRQSREGQVTEEVEGAARLNGPGqgGTARYTRPEARTIKLPKGTLFPTAHTIRLIETANKGGRILSRPLFDGQGE- 180 Magneto...
goetting:OCA5_c22360 187 EKVYNTFVVIGQPVSAgraa----essdVATANDKLKAVTRWPVTVSYFDraakPGSGEQTPIYGMSFELYEDGISRALV 262 Oligotr...
WP_013045493         182 DALMTTNTVIGGWRSSaapn-----------sfgGFADKGFWPVHVAYFK----PLATASEPSYEINFSLQSNGVVRDYE 246 Candida...
QianUST:TMO_2564     212 DSLSFVSAHIGRPTEIaadqd---wpvqAGEAADALRTATVIPMRLAFFK----PDDRSETPIYELLYQIQPNGVVRRFD 284 Tistrel...
ACI98939             199 DGASGVSALIAKPAKVgdlk----------trsRDLVRERGWPVFMAFFP----TDTQEMLPEYETKLTILDNGVVESML 264 Rhodosp...
WP_014248105         198 EGPTEVSTVAGKPGAPkeag-----------kdpLLKVGKSWPVRMAFFP----LQSDSAQPEYEMSLRLLENGIAESMQ 262 Azospir...
CCC99953             209 EGATEVSTVIGAAIQAkedg-----------adpLLKGKKAWPVRMAFFP----LKSDSAQPEYEMSLRLLQNGVAESMQ 273 Azospir...
IGS:MICA_1957        221 EGPVDVSVFIGKKINAmder------sfgTTVDPTLVNTPAWRMHLAFFP----QSNPEPQSDYEMDAVFHDNGMISHMY 290 Micavib...
Q2RSM6               185 EGPSLVTAFIGPPLPAgaeatkglsgpvSNEAGKALLNTPSWRMTIAFFP----PDDREDLPNYEVRVRYHDNGVAQEMV 260 Rhodosp...
CDK99274             179 DGPYEVNALIGKQSQAlpak-----------pvsALLGTPHWPMHLAFFP----VSSPEEVPNFEMSLAYHPNGVAQEIV 243 Magneto...
Q2W3D9               181 EGALETSAQIGRAVTPqtaa-----------vtsPLLNSPAWPMRMAFFP----MGSTDPLPEFEMSLNYHANGVAEDIE 245 Magneto...
goetting:OCA5_c22360 263 LDYNDFVINGKIDKLEVSD 281 Oligotropha carboxidovorans OM5
WP_013045493         247 IDYGEFSIKANLLNIEdvs 265 Candidatus Puniceispirillum marinum
QianUST:TMO_2564     285 IDYGEFAISARLVSVENrp 303 Tistrella mobilis KA081020-065
ACI98939             265 IDYGDFKVRAVLESLEAAP 283 Rhodospirillum centenum SW
WP_014248105         263 IDYGDFTVNAVLEKIEALP 281 Azospirillum lipoferum
CCC99953             274 IDYGDFTVNAILEKVEALP 292 Azospirillum brasilense Sp245
IGS:MICA_1957        291 VTYDEFSVTQSLVALEKLP 309 Micavibrio aeruginosavorus ARL-13
Q2RSM6               261 QDFGFFSLRTLLKDIKPLP 279 Rhodospirillum rubrum ATCC 11170
CDK99274             244 QTFKSFSLKGRLDSVEALP 262 Magnetospirillum gryphiswaldense MSR-1 v2
Q2W3D9               246 QIFKTFSLKGRLESIEILP 264 Magnetospirillum magneticum AMB-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap