Conserved Protein Domain Family
DUF1843

?
pfam08898: DUF1843 
Domain of unknown function (DUF1843)
This domain is found at the C-terminus of a family of proteins that are functionally uncharacterized. The presumed domain is about 60 amino acid residues in length and is found independently in some proteins.
Statistics
?
PSSM-Id: 370178
View PSSM: pfam08898
Aligned: 16 rows
Threshold Bit Score: 63.1062
Threshold Setting Gi: 503335418
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:AciPR4_3596  11 PlYAVSIHNAAASGDLAAMKKTVTDAEEHLKTYGNVGAAVEALKVEIAKLES 62  Terriglobus saanensis SP1PR4
jgi:AciPR4_3597   6 P-YGVAIQQAVASGDLQKMKSTLLTAEKHVADYGDVSSALEVLKIEIAKLEA 56  Terriglobus saanensis SP1PR4
Q63NT8           10 TpYGVAIHQAIADGDLAQMKSLRTQAQALLAQQGNLATALELLEVEIAKLER 61  Burkholderia pseudomallei
Q4KES1           10 PpYGVAIQSAISEGKLPEMKALLAKRDPARNEPKDLHNAYEQLAQEVARLER 61  Pseudomonas protegens Pf-5
Q8XYN3           11 PpYGVAIHDAIIDGDLRTMKALLSRAEAVLDEQGDLRTAVELLRLEIAKAER 62  Ralstonia solanacearum
Q4KES3          150 PlYAVALQQAQASGDLARLKALVAQGEQQLANADNLTQAVQQLQAEISRLEQ 201 Pseudomonas protegens Pf-5
Q8XYN1          140 PmYAVSLQQAKASGDLGQMKALASLAEKQLADAPQIKAELDKLHTEIAKLEG 191 Ralstonia solanacearum
CBS90164         11 P-YGVAISDAIVSGDLAKMKEVAAAAEQHLAEHGDVASILHLLKVEIAKAEA 61  Azospirillum lipoferum 4B
WP_014249604     11 PmYMATMTDAIAGGDLATMKQVAAEAEQHLATYGDVPGLLQLLKVEIAKAEA 62  Azospirillum lipoferum
CBS90165          9 L-YGGAMTEAIASGDLSKMKEVASAAETHLNENGDVASMLEILKIEIAKAEA 59  Azospirillum lipoferum 4B
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap