Conserved Protein Domain Family
WRC

?
pfam08879: WRC 
WRC
The WRC domain, named after the conserved Trp-Arg-Cys motif, contains two distinctive features: a putative nuclear localization signal and a zinc-finger motif (C3H). It is suggested that the WRC domain functions in DNA binding.
Statistics
?
PSSM-Id: 370168
View PSSM: pfam08879
Aligned: 30 rows
Threshold Bit Score: 61.9043
Threshold Setting Gi: 548843894
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EFJ17791      158 SEPGRCRRTDGKKWRCAKPVVAvDQKYCERHIHRGRNRSKKSK 200  Selaginella moellendorffii
EFJ20153      298 nEGSQCRRMDGKGWRCHRTTQP-DYSLCDYHLDKFRETNQRKL 339  Selaginella moellendorffii
XP_002275770  189 lEGSRCSRVNGRGWRCHQQTLV-GYSLCEHHLGKGRLKSMTSV 230  wine grape
XP_013747409  156 EEGSRCSRVNGRGWRCCQQTLY-GYSLCEHHLGKGRVRSTNKS 197  rape
XP_006662400  162 AEVWTCKKNDGKRWHCQRRVSQ-PNSLCDYHSDQKRAYYNPLY 203  malo sina
EER91549      171 ARVWMCKKNDGRRWHCNRPVSQ-PDTLCEYHFVQKRSYLNPDF 212  sorghum
XP_015624807  180 ATIWFCKKNDGKKWHCRSIVDR-PNALCDYHLARSRSSYTPSS 221  Japanese rice
VDC74715        8 PDEFRCNRSDGKQWRCKRRALE-GKKLCETHTSQLTQKRDREK 49   field mustard
Q8H1S7          8 PDEFRCNRSDGKQWRCKRRALE-GKKMCESHHSQQSLKRSKQK 49   thale cress
XP_004233815    8 PDDLRCNRTDGRQWRCKRRVEE-GKKLCEIHYVQGRHRQMKQK 49   tomato
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap