Conserved Protein Domain Family
DUF1830

?
pfam08865: DUF1830 
Domain of unknown function (DUF1830)
This family of short proteins is functionally uncharacterized.
Statistics
?
PSSM-Id: 400982
View PSSM: pfam08865
Aligned: 53 rows
Threshold Bit Score: 85.3082
Threshold Setting Gi: 123501405
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKQ70525           16 CFYINRTSHTQVGRitITNVSNSLIERVIRPGESFLFEADVEAWLEVHLLTSARSILLKTLPCSDLRV 83  Oscillatoriales cyanob...
BAG03320           40 CVYVNNTGKMAILRnnVDLIAKWR-EVVVEPGEEFCFQAPEGGHLDIFTYEMAAMILEHRIPCRELAi 106 Microcystis aeruginosa...
CAK29350            6 CSYRNDDDRMVILR--CFGSDGFYLERVIFPFEVLNFVAPPEAEVEIWSHSIGSPELVATHPIRELVA 71  Synechococcus sp. RCC307
jgi:Cyagr_0633     15 CGYRNSSDRMVILR--CIGPGQFFLERVVFPFELLTFQCPEMSEVEIWTHGLGGPELLESIESRELIM 80  Cyanobium gracile PCC ...
WP_015108603        6 CSYRNCSERMRIIR--CCGPEDFFLERVVFPFEVLTFHCPPATDVEIWARDSLGIVLTEQLPADALAM 71  Cyanobium gracile
Q46IY2              7 FSYRNITSSMVILK--CIGPDRFFLERAIFPQEVFSSVAPEGSQLEIWGIESYGPNLEQRLRVTAFNK 72  Prochlorococcus marinu...
Q7VCK9              4 FSYCNDSNRMVVLR--CIGSNHFFLERVLFPKQVIEFLAPRDSKVEIWGNELYGPKLEQRIRVGSIMN 69  Prochlorococcus marinus
WP_015194128       18 CCYINRTNKIVIVR--LHGIPKRDCERVIFPQERFLFEAPIVSELEVVQAYSTN-IFKDMIPCSELIV 82  Stanieria cyanosphaera
WP_012598804       18 CCYCNDTEQTIIAR--ITNLNQRDCERVIFPKECFFFNVPPDAKLEIYRQSIIG-VIEDVIPCVELQt 82  Gloeothece citriformis
jgi:Cyan7822_5435  18 CCYCNRTEQTIIAR--ITNLDEHDCERVVFPQECFFFTAPYQAKLEIYRQSALG-VLQELIPCLELQI 82  Gloeothece verrucosa P...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap