Conserved Protein Domain Family
DUF1825

?
pfam08855: DUF1825 
Domain of unknown function (DUF1825)
This uncharacterized family of proteins are principally found in cyanobacteria.
Statistics
?
PSSM-Id: 400972
View PSSM: pfam08855
Aligned: 13 rows
Threshold Bit Score: 129.468
Threshold Setting Gi: 81710948
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015162423                1 MGFFDSDIIQQEAKQLFDDYQHLTQLGGKYGKFDREGKIAFIERMETLLDRYKVFMKRFELSDDFMAKMTVEQMNTQMSQ 80  Ch...
Q7VAP6                      1 MAFFESEIVQEEARSLFSDYQNLMKLGGDYGKFDREGKKMFIGKMESLMERYKVFMKRFELSEDFQAKMTVEQLKTQLGQ 80  Pr...
dbpsupku:SYNPCC7002_A2244   1 MGFFDSEIVQQEAKTLFEDYQNLVQLGSDFGKFDREGKKMYIDQMESVMDRYKIFMKRFELSDDFMAQMAVEQMKTQLGQ 80  Sy...
WP_010475860                1 MGFFDSDIVQQEAKQLFEDYQSLMQLGGSYGKFDRDGKVLYIERMEEMMDRYRVFMKRFELSDDFMARMTVEQLQTQLGQ 80  Ac...
WP_015168356                1 MGFFDSDIVQQEARNLFQDYQALIELGSNYGKFDREGKKLFITKMEEMMDRFAIFTKRFELSDDFMAQMTMKQMQSQLGN 80  Sy...
jgi:Pse7367_0133            1 MGFFDSEIVQQEAQSLFRDYQSLMELGGNYGKFDREGKKLFIARMEEIMDRYKIFMKRFELSDDFMAQMTMKQLQTHLGG 80  Ps...
Q8DHB5                      1 MGFFDSEIVQQEAQRLFQDYQQLMQLGSEYGKFDREGKKIYIEKMEELMDRYRIFMKRFELSDDFMAQMTIKQLETQLSQ 80  Sy...
Q7NMI4                      1 MGFFDSEIVQQEAREFYQEYQELMQVGSNYGKFDREGKKIFIEKMEELLDRQRIMLKRMELSDDFMAQMAMKQMSDQLNT 80  Gl...
XP_005847926                7 SKLFNSEIFMKEFIDLQQDLQQLIVMMHKFADFDLEGKKIFVDQLEKMGEKMRIIQARIKLSDDELGNWLLRQQNIQMLN 86  Ch...
Q2JH76                      1 MSFFDSEIVQEEAKQLFQDFQNLMQLGQRYGQFDREGKKIFIEQMEELLERQRIFMKRLELSDDFMAQMTIKQLQTQLGG 80  Sy...
WP_015153160                1 MGFFDSDIVQQEAKQLFEDYQALIKLGNSYGKFDREGKKLYIDQMEAMMERYRIFMKRFELSEDFMAQMTVEQLRTQLNQ 80  bl...
WP_015123342                1 MGFFDSEIVQREAQDLFVDYQSLVQLGGDYGKFDREGKKLYIEKMEEMMDRFRIFMKRFELSEDFAAQMTVEQLKTQLNQ 80  Sy...
WP_012593965                1 MGFFDSEVVQQEAKQLFEDYQSLMQLGGEYGKFDREGKKIFIDKMEELMERYKIFMKRFELSEDFMAKMTVEQLKTQLGQ 80  Ri...
WP_015162423               81 FGMTPMQMFDQMNLTLERMKSEI 103 Chamaesiphon
Q7VAP6                     81 FGMTPDQMFEQMNLTLDRMKSQL 103 Prochlorococcus marinus
dbpsupku:SYNPCC7002_A2244  81 FGMTPQQMFDQMNLTLERMKAQI 103 Synechococcus sp. PCC 7002
WP_010475860               81 FGMTPQQMFDNMNRTLERMKQEV 103 Acaryochloris
WP_015168356               81 FGVTPQQMFEQMHVTLERMKSEL 103 Synechococcus sp. PCC 7502
jgi:Pse7367_0133           81 FGITPQQMFEQMNTTLERMRSEV 103 Pseudanabaena sp. PCC 7367
Q8DHB5                     81 FGMSPQTMFDQMHQTLERMKAEV 103 Synechococcus elongatus
Q7NMI4                     81 FGMTPQQMFQQMESTLEQMKAQI 103 Gloeobacter violaceus
XP_005847926               87 ASTNWDLVLSGLGNELAEMRrmi 109 Chlorella variabilis
Q2JH76                     81 FGLSLTQMFDQMHQTLERMKAEA 103 Synechococcus sp. JA-2-3B'a(2-13)
WP_015153160               81 FGITPQQMFEQMHNTLERMKAEL 103 blue-green algae
WP_015123342               81 FGVTPQQMFDQMHTTLERMKREL 103 Synechococcus sp. PCC 6312
WP_012593965               81 FGITPQQMFDQMNMTLERMKSEI 103 Rippkaea orientalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap