2NVN,2IT9


Conserved Protein Domain Family
DUF1818

?
pfam08848: DUF1818 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1818)
This presumed domain is found in a small family of cyanobacterial protein. These proteins are functionally uncharacterized.
Statistics
?
PSSM-Id: 400967
View PSSM: pfam08848
Aligned: 45 rows
Threshold Bit Score: 117.313
Threshold Setting Gi: 427347510
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NVN_A            7 REGAGWRLGWDETAHRYPGLVGTTDWAVELTAAEXADFCRLVQQLAETIAAIAPELXPEERLQIEA----------ESAL 76  Synechococcu...
Q7V5U9            4 QEGPGWRLARDPARKAFPVLIGGEGWAIELTQDEWQCLQSLVVELTDQHQQLVDQLLAEESVCLEM----------ERQP 73  Prochlorococ...
Q8DIY5            4 RVGQGWRVGWRSDQH-YAGLVGAEDWATELTDAEFRAFVELFRQLHEQLQAIAPELMPEEMITLSG----------HNDA 72  Synechococcu...
Q7VA82            4 NEGPGWRLQKDPSKQKYSILIGGENWAVELSEKEWDCLCPVVFELIDQYEELQKQLMPEEKIFLEI----------ERSP 73  Prochlorococ...
2IT9_A            5 KEGPGWRIIFDSSRDNFSTLIGGETWAIELDKSEWKILVEVVXELCDQYKLVKEQLXGDEDITLEL----------ERRP 74  Prochlorococ...
WP_011933883      4 QEGPGWRLARDPQRHPYGALIGGETWAVELTESEAGALASLIQDLVDHHAALRGQLMDEELITLEL----------ERIP 73  Synechococcu...
CAK28753          3 AEGAGWRLAVDPSRDGYQALIGGEGWAIELSLEELASLSALCVRLQEQHLAIADQLMAEEVIEIAL----------ERGP 72  Synechococcu...
jgi:Cyagr_3144    4 cEGPGWRLVVDPARWPFTALIGGDGWATELTAAELRALQLAAARLTAQHRAMANVLMAEEAVAMEVelpigdpeagEGGS 83  Cyanobium gr...
ASGPB:GKIL_2690   5 REAEGWIVAWESERTPYCTLVGGRDWSFELTLLETRQLLHTAEWLQRQWQASLRELMDEEALSCTA----------GNAA 74  Gloeobacter ...
Q7NKS8            5 RETDKWIVAFDPEREPYCALVGGADWSFELTRPETVQLLAALVSLLRQWQVSLAELMDGESAELGV----------GNLY 74  Gloeobacter ...
2NVN_A           77 LWLEAEGFADAYELRLILAS----DRRVEACWPAAAVPALVAATHTL 119 Synechococcus elongatus PCC 7942 = FACHB-805
Q7V5U9           74 WWACLDGDRHSWSLQVILQGdgekARGAEGCWSVPAAQAMATAMRTT 120 Prochlorococcus marinus str. MIT 9313
Q8DIY5           73 VQLELEGYPHAYSLHLIVLG----DRRVEGTWPAPVPPDFLLACCEL 115 Synechococcus elongatus
Q7VA82           74 WWACINGTKENWSLKLILSGedveGRGLEVFWPVYTASVIVSAMRTM 120 Prochlorococcus marinus
2IT9_A           75 WLAILNGDQYGWNLRLILSAsglfNRGAEVYWPRHVTNNVVNAXRSx 121 Prochlorococcus marinus str. NATL2A
WP_011933883     74 WWGSLEGDREGWSLQMILRPedgcERGVEVFWPAPAAAAVAAAMRTL 120 Synechococcus sp. WH 7803
CAK28753         73 WWLELSGDRERWGLRFVLSSp--nGRGAEGMWQPPASGELCLALAKa 117 Synechococcus sp. RCC307
jgi:Cyagr_3144   84 LWLGLDGDRHRWTLQLVLTPap-gGRGIEGGWSAAASEAFSAALERL 129 Cyanobium gracile PCC 6307
ASGPB:GKIL_2690  75 LELEMSGTEHVWQLKLRLVG----GRGAEGSWVSPDAAQVLAVLAEl 117 Gloeobacter kilaueensis JS1
Q7NKS8           75 VELNLSGTAAAFGLRLRMVE----GRAAEGSWPAPIAAQVIEALEQL 117 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap