Conserved Protein Domain Family
SRC-1

?
pfam08832: SRC-1 
Steroid receptor coactivator
This domain is found in steroid/nuclear receptor coactivators and contains two LXXLL motifs that are involved in receptor binding. The family includes SRC-1/NcoA-1, NcoA-2/TIF2, pCIP/ACTR/GRIP-1/AIB1.
Statistics
?
PSSM-Id: 400955
View PSSM: pfam08832
Aligned: 33 rows
Threshold Bit Score: 73.1728
Threshold Setting Gi: 765147571
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011475689  675 KGHKKLLQLLTSPTEELGIggsgtsgppvpppnsSRNDV-GLDCKDASGGMTSPsStGVSsssaassqaagqgtsLSLSL 753  Japanese medaka
XP_014341047  629 lGNTKLVQLLATTAEQQl----------------kHADGdGTNAKEFLSCVGVSaCsTAS---------------TVPGT 677  coelacanth
XP_024098234  629 tSH-KLVQLLTTTAEQQl----------------rHADI-DTSCKDVLSCTGTSnS-ASA---------------NSSGG 674  Sumatran oran...
XP_004081302  644 KCHTKLLQLLTTKPEPLEtp------------lsP--GA-DGECKD-QAGSGV----------------------RAGHT 685  Japanese medaka
7_pfamImport    1 KGHTKLLQLLTTKSESADPcss----------psP--ED-EQTCKD-QPG-------------------------GVGGS 41  
CAF97770      584 KGHTKLLQLLTTKADPSDPcsp----------sgP-LGD-DQDFKD-QLGVIG----------------------GVDGA 628  spotted green...
XP_004565576  621 KGHTKLLQLLTTKLEPSDPcsp----------tgA-FGD-DQICKD-QLG-------------------------GVGGV 662  zebra mbuna
XP_011484481  624 KGHTKLLQLLTTKLEHSDScss-------------pgPL-GDDCKDQLGGVAG-----------------------VGGL 666  Japanese medaka
XP_016152527  532 tSH-RLVQLLASTAEQQl---------------rHHADA-DTSSKDSLACAGIAg--------------------NSAGN 574  collared flyc...
XP_027311252  637 tSH-KLVQLLATTAEQQl----------------rHADA-DTSCKDSLACAGAPgTlAAG---------------NPPSS 683  mallard
XP_011475689  754 SSANYTGSLQEKHKILHKLLQNGNTPDEVAKITAE 788  Japanese medaka
XP_014341047  678 PCPLSHSSLTERHKILHRLLQEG-SPSDITTLSLE 711  coelacanth
XP_024098234  675 SCPSSHSSLTERHKILHRLLQEG-SPSDITTLSVE 708  Sumatran orangutan
XP_004081302  686 GGSTHATSLKEKHKILHQLLQNSTSPVDLAKLTAk 720  Japanese medaka
7_pfamImport   42 GHNNHPTSLKEKHKILHKLLQNGASPVELAKLTAE 76  
CAF97770      629 GHNNNPTSLKEKHKILHRLLQTSTSPVELAKLTAE 663  spotted green pufferfish
XP_004565576  663 GHNNHSTSLKEKHKILHRLLQNSTSPVELAKLTAE 697  zebra mbuna
XP_011484481  667 GHSNQSTSLKEKHKILHRLLQNSTSPVELAKLTAE 701  Japanese medaka
XP_016152527  575 SCPSSHSSLTERHKILHRLLQEG-SPSDVPGLApe 608  collared flycatcher
XP_027311252  684 TCPSSHSSLTERHKILHRLLQEG-SPSDITTLAME 717  mallard
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap