Conserved Protein Domain Family
DUF1804

?
pfam08822: DUF1804 
Protein of unknown function (DUF1804)
This family of bacterial protein is uncharacterized.
Statistics
?
PSSM-Id: 400949
View PSSM: pfam08822
Aligned: 15 rows
Threshold Bit Score: 162.504
Threshold Setting Gi: 545653627
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q728A0                2 AHDEATRRAARSAYAYDQLPLERAAAKAGVPASTLARWKREAKAEGDDWDKVRAANALASGGVEDVARQMLTDYVVQHKT 81  Desulfov...
CAJ53986              3 AYAPETKEAIRNEYITSRKTLAEVASSFNVALSTAARWKGEAKKLSDDWDILREHFFLVGSGMENITRQMFIEYVLQHKK 82  Lawsonia...
rhodo:RCAP_rcc00986   3 rnNEDVRRKARSDYVFRRFTAATIAAAYGISEATVGRWKKAAKEQGDDWDKARTAHVIAGEGVEAVVSTVVEDFMIQAQE 82  Rhodobac...
WP_021761113          2 kdySKVRKKMRQMYAAGK-SIDEIAVLFDLQPASVQYHRRIDARNGADWDALRVECRVGETATEEAHQQFLGTLFGCFAE 80  Desulfov...
Q3IGH5                2 AHPAEKKNAVRHSYVTELLALSVAGIKHSVADGTARRWKMEAKDNGDDWDLARAASRRSEGTAGEFTTDFIEEFTIQVNE 81  Pseudoal...
YP_002221421          2 AHDQKVRNQLRAKYL-QGMPLTTAADVCKVSYQTARNWKRASKEAGDDWDIARSAQRMSRTNIDNMTSQVVEEMSVQFLA 80  Burkhold...
WP_012637018          2 AHSQETRQAVRRAYVVERLALERAAKRNGVSYHTARAWKKKAREDGDDWDRARAATRMAQGGLGDLTAQLLEDFAILFQH 81  Thioalka...
WP_011795988          2 AHAQEKRTQLRGLYIYQRLPMEAACKKVGVPRSTANRWKSEALEKGDDWDTVRAAVALGDDNFASLSKKLLEDYLVQHQA 81  Acidovor...
WP_014780597          4 A--PEARKRARDAYVHERQTLLGAAQAAGISLGTANRWKKADSGTSKDWDKARAAASLSGDGLQAVAMAVLEDYLLQHQA 81  Thiocyst...
jgi:HSM_0665          2 AHDEKVRALVRRYYVFDRFTLEQSAQKADVSFGTARRWKAQALNKGDDWDKARDVHIMAGGEVNMISQGLLAGFILQYRT 81  Histophi...
Q728A0               82 LIDHLRDETtgeRMSPRDKADILASLADSFNKTVAACRRVMPETNELAVALEVLGLLG-DYVREHFPGHAPALLEVLEPF 160 Desulfov...
CAJ53986             83 ILEEIQEDM---DISTSTKVHMLAKLSSSLSKTVEASRHALPKTDRLATALDVMRKLV-QFTQHRYPQHALYLLEILEPF 158 Lawsonia...
rhodo:RCAP_rcc00986  83 ILEEIKSGS----HTTQEKVSMLVSLSDAMTKMAASAKKFAPKISELGVAQHVMREML-DFVREHFPHHSAAILEIIEPF 157 Rhodobac...
WP_021761113         81 ELPKLREIT-----DAAKRLDILRTYSRTYSELIRAV-RTDPRIDVGEVVAKTLDLLVdQAIEDGRDDLALWLQASLDAI 154 Desulfov...
Q3IGH5               82 TFELLKSAEg-aALPLEQRTKVLSSLTDMMSKVMKVSGG-NKRLEKRTIATEVLKILA-KFVSTKYPEFAPEFVEILTAF 158 Pseudoal...
YP_002221421         81 MLEELKNNQ---KLQPVQKADILARLSDSFIKTVNAAGRSNPKLATLSICMDVLRDFA-SFVQTKYPKEHARFIAYLEEF 156 Burkhold...
WP_012637018         82 TVEEVQSGQ----YSALQKAEAISRLSDAYTKTVKAAGGGDPRIARLSVALEVLERLA-GFVQAQFPEHAGALMAVLEPF 156 Thioalka...
WP_011795988         82 TMDQLREAT---GMSARDRAETLASMSDSFNKTMASFKRLAPDLDRQAVQIDVLQRFV-TFAQVRFPQHLQAVAEMLEPF 157 Acidovor...
WP_014780597         82 TLAALRDPAt--EIGPLQRAEVLSRLTDSFHKAMAAHAKLSPELSRLAIAMEVMQRMA-NFVRARYPQHTNAFLDILEPF 158 Thiocyst...
jgi:HSM_0665         82 TMDELQQNT---ELSAKDKVMLLAALADSFTKMTAASKRILPEVSELAVAMRTVELFG-EYIHQHHSSLMEPFIDALNGF 157 Histophi...
Q728A0              161 GYELSKH 167 Desulfovibrio vulgaris str. Hildenborough
CAJ53986            159 GNILITE 165 Lawsonia intracellularis PHE/MN1-00
rhodo:RCAP_rcc00986 158 SERLAEi 164 Rhodobacter capsulatus SB 1003
WP_021761113        155 RDKVRKE 161 Desulfovibrio gigas
Q3IGH5              159 GPRLDKE 165 Pseudoalteromonas haloplanktis TAC125
YP_002221421        157 GQEVAKK 163 Burkholderia phage KS10
WP_012637018        157 GQELAAA 163 Thioalkalivibrio sulfidiphilus
WP_011795988        158 GEELAKv 164 Acidovorax citrulli
WP_014780597        159 GETLGDA 165 Thiocystis violascens
jgi:HSM_0665        158 GQTLNEE 164 Histophilus somni 2336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap