1GPQ,1UUZ


Conserved Protein Domain Family
Ivy

?
pfam08816: Ivy 
Click on image for an interactive view with Cn3D
Inhibitor of vertebrate lysozyme (Ivy)
This bacterial family is a strong inhibitor of vertebrate lysozyme.
Statistics
?
PSSM-Id: 400943
View PSSM: pfam08816
Aligned: 18 rows
Threshold Bit Score: 119.777
Threshold Setting Gi: 500073846
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GPQ_A                         10 AKGETTKAAFNQMVQGHK-LPAWVMKG-GTYTPAQTVTLGDETYQVMSACKPHDCGSQRIAVMWSEKSNQMTGLFSTIDE 87  Escherichia coli K-12...
P58483                         36 LQQPVYKARWQKMVKGQKnLPAWARKGaGTSGPYENITWGAQQYKVGSLCKPHDCSNNFMWVAFSNDKKHVWGLRVTVAD 115 Yersinia pestis...
goetting:EBL_c31360            29 ATGSATKAGFAAMVKGHT-LPGWVTRG-ATESPAHDVTLAGKHYQVFSACKPHDCASERIAVIYSADDKTMAGLFSKTDE 106 Shimwellia blattae DSM 4481 = NBRC 105725...
PRJNA212980:JCM7686_pAMI5p220  34 STNSEMRASFDKMATGWT-VPDWVLSG-PVTSPSQMVQFGGKEYLVMTGCKKHDCGNNQIAVLYQKTDKVMFGLLLRADS 111 Paracoccus aminophilus JCM 7686...
WP_011749859                   69 GKDEGLTAAVEKMAEGHQ-MPEWLREG-AVISPSQKVGFGGQEYLAMTACKQHDCAANQFAVLYAPGSGTAHGVLSVRD- 145 Paracoccus denitrificans...
PNU:H681_25220                 39 AADQRYRQAWYSLVKDAPpLPDWVMHLtGTSMPMHSVDELSGKYLVGELCEAYDCSKHRLYVAFTWDKQKAYALYVTVPE 118 Pseudomonas sp. ATCC 13867...
1UUZ_B                         10 LGQPGYKATWHAMFKGESdVPKWVSDAsGPSSPSTSLSLEGQPYVLANSCKPHDCGNNRLLVAFRGDKSAAYGLQVSLPD 89  Pseudomonas aeruginosa...
Q7NZR4                         39 ARQPDYQAAWMSMTAGAKdAPEWLREArATSAPYHSAFIAGKRYLAGEMCKPHDCASNRFFGLFSADKRRAVGLLVTVAD 118 Chromobacterium violaceum...
Q63W35                         40 iAQSAHRAEWKRMISSEKrVPGWLKSDnRVSSPYRREQVEGASYLVGWMCKPHDCAANQFYGVIDEDSHRMWGMLVTLPQ 119 Burkholderia pseudomallei...
ACR68365                       33 MAQPSYQQSWKQALQGEKdLPSWVRSGqGTSTPPQTLTWQDKAYQVGMICQPHNCGNRQVFIAFSGDRRQAWALRVTLPD 112 Edwardsiella ictaluri 93-146...
1GPQ_A                         88 KT-SQ-------EKLTWLNV-NDALSidgktvlfAALTGSLENHPD 124 Escherichia coli K-12
P58483                        116 KP-EAldnpskfATYQWLGRpNENIQ--------AMLTAQLEKDPN 152 Yersinia pestis
goetting:EBL_c31360           107 KT-SS-------EKLSWLNV-PDDLSidgktvlfAALSGSLENHPE 143 Shimwellia blattae DSM 4481 = NB...
PRJNA212980:JCM7686_pAMI5p220 112 AD-GP-------QTLNWMGMgGNAETvdgrtilyAATTGSLANHPk 149 Paracoccus aminophilus JCM 7686
WP_011749859                  146 GE-GA-------ELLTWLGMaGGPETidgrtilyAALTGSLANHPQ 183 Paracoccus denitrificans
PNU:H681_25220                119 GL-PPdqassrhASLRWLGEpNDTMK--------GILDEELKSDPN 155 Pseudomonas sp. ATCC 13867
1UUZ_B                         90 EPaEVmqtpskyATYRWYGEpSRQVR--------ELLMKQLESDPN 127 Pseudomonas aeruginosa
Q7NZR4                        119 VP-EAvdhpakhASYRWFGKpDKNQR--------AYLMQQLKQDPN 155 Chromobacterium violaceum
Q63W35                        120 TP-GAydapskyASFRWFGKpDERMK--------TYLQDQLKQDPN 156 Burkholderia pseudomallei
ACR68365                      113 SD-AAmlhpskhVHFQWLGNpDASLK--------TLLMKQVTSQPg 149 Edwardsiella ictaluri 93-146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap