Conserved Protein Domain Family
Phage_tail_3

?
pfam08813: Phage_tail_3 
Phage tail tube protein, TTP
This is a family of phage tail tube proteins. A few members have an associated bacterial Ig-like domain, pfam02368, at their C-terminus.
Statistics
?
PSSM-Id: 370135
View PSSM: pfam08813
Aligned: 11 rows
Threshold Bit Score: 145.652
Threshold Setting Gi: 75095307
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003813414   3 SGWPELNERVVRAVNTAsntfALEGIDTTKVGRFSKGQGIGTATPVSTWVDLSQVTNVAKTGGEQQFYQWRYVEDrNsRQ 82  Bordetella bron...
Q6LHS9        51 SGWSTINDRVAKVGATS----KLMGLDTSDTTVFPSGTGGGKLTKVSDWQQITQVLSSETSGGDQQFTTYSFLEN-D-FE 124 Photobacterium ...
Q8XYR9        51 SGWARLDGRVARADAVTadafAFEGIDTTDTDVYPVGTGIGSVLPVLTWQQITQVLQSAASGGDQQFYNYSFLEDtS-DE 129 Ralstonia solan...
Q4KA77        51 SGWSKLDNKVVRIKAATataiTLEGIDTTDTQLFPAGNGAGTMKKILTWVLIPQVTDLAFSGGEQNYLDVTFLED-D-QG 128 Pseudomonas pro...
Q65PT4        16 QRFA-VDSSEGLAGTGTtlerSVDG---------------------SSWDEIADIKTIPELGGDTEKIDVTTLAD-D-RR 71  Lactobacillus j...
Q6XQC7        51 STWAKMVSRVLIVTDAQetsiTLAGIDTSDTLVFPAG-GTMSFAKITGWTEIPCVQEIGQDGGEQQYYTYQCLSD-D-KE 127 Escherichia vir...
Q45PZ9        52 SSWSKLSEKQLRVVTSTattiTVEGIDTTDPLQFPAG-GTASIYKVLTWYEMPCVQDVSTDGGEQQFVTYQCLAD-D-RE 128 Escherichia vir...
Q333F1        52 SASTLLADKQVRVTAVSgtsvTVEGIDTSSTTKFPAG-LTGEVVKILSWFEVPCVQDVSTDGGEQQFVNFQCLSD-D-RE 128 Escherichia vir...
Q4ZSQ0        51 SGWTRLNDRATRVSKSLsgtfALENINTTNLQPYPAGSGTGSVRKVTSFVEVPQITEVNTSGGDQQFLTFGFLAD-D-DD 128 Pseudomonas syr...
Q7Y5K3        50 AGAPFLNNTASVVGAGS----TLLGVDGRRLA--GTSSGVVRLTDVGAFTNFAQTIGVSQYGNEQAFAQVNFLEDsSgRQ 123 Xanthomonas vir...
Q7VTX8         3 SGWPELNERVVRAVNTAsntfALEGIDTTKVGRFSKGQGIGTATPVSTWVDLSQVTNVAKTGGEQQFYQWRYVEDrNgRQ 82  Bordetella pert...
WP_003813414  83 RQRPTYKSAKFITLTLDYDPALAWYEALKEADAAKDAVVLRAKLPNHDEL-YYLVYPSFDSDPSMELDVNMQNTATFSMM 161 Bordetella bron...
Q6LHS9       125 TQIPTRKSPVVLTLSIADDDSLPGYIALKKASDAKETGVVRATLPNGATL-YYHAYVSVNETPSMTKDQVMAIAVTISLI 203 Photobacterium ...
Q8XYR9       130 KQIPTIRSARSYTLTIADDPALAHYALLEAADEDREPRAVRMKLPGGAPI-YFRAYIAFSKVPTTTKNEAMATTVTLSLT 208 Ralstonia solan...
Q4KA77       129 KQIPTDKSAASMVLTIADDPAQPFNAVLMSADAGKKVQAARLNLPGNDTL-LYGAYTSFSKQPAVSRNNLLTRTVNLALQ 207 Pseudomonas pro...
Q65PT4        72 KQIEGIQNASNVQFQAVYK-GASFAKALAQAGDRKQYQ-WKVTYPDGMTAtMKGSY--NIKFGAVSVNGALGYTITITVS 147 Lactobacillus j...
Q6XQC7       128 QQIPTFKSAVSLTYTFAHEFDNPIYPILRKLDSSGQVTAVRMYVPKASEMrMWAGILSFNDIPSTQVNEMETVELAVSLK 207 Escherichia vir...
Q45PZ9       129 QQIPTYKSAVNTTYTFAHEFTNPIYPVLRNYDESGALIAIRAYVPKAGEVrLWTGTIAFNETPNVSVNEIETVSVAITVR 208 Escherichia vir...
Q333F1       129 QKIPTYKSAVTNTFTFAHEYTNPVYPVLRDYDESGQVVAIRLFVPRAQEMrLQSGTIAFNDTPTIGVNEIETVSIAVSIR 208 Escherichia vir...
Q4ZSQ0       129 RQMPTTKNPISMSFTVADDPDLPYVAVVEAADDDKQARVLRLNLPGGSSI-VYNAYVSITTTPTLGRNNLMTRVMTLSLA 207 Pseudomonas syr...
Q7Y5K3       124 LSVPTTISPLVITLRFAYDPDATYFDAAKSVSDRNALVVLRRQLPNGDRF-LNVAFMTFNDSVSVAENAPMEVSAVFSCV 202 Xanthomonas vir...
Q7VTX8        83 RQRPTYKSAKFITLTLDYDPALAWYEALKEADAAKDAVVLRAKLPNNDEL-YYLVYPSFDSDPSMELDANMQNTATFSMM 161 Bordetella pert...
WP_003813414 162 SDFTRYAP 169 Bordetella bronchiseptica
Q6LHS9       204 VRPTRYAK 211 Photobacterium profundum
Q8XYR9       209 GEVTRYAG 216 Ralstonia solanacearum
Q4KA77       208 SEPTRYLT 215 Pseudomonas protegens Pf-5
Q65PT4       148 DGPTFAAA 155 Lactobacillus johnsonii
Q6XQC7       208 GDFTFISS 215 Escherichia virus T1
Q45PZ9       209 GRYSFLAA 216 Escherichia virus KP26
Q333F1       209 GRLSSVAA 216 Escherichia virus Rtp
Q4ZSQ0       208 GRPTRYSA 215 Pseudomonas syringae pv. syringae B728a
Q7Y5K3       203 GPTTLVRG 210 Xanthomonas virus Xp10
Q7VTX8       162 SDFTRYAP 169 Bordetella pertussis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap