2YPV


Conserved Protein Domain Family
Lipoprot_C

?
pfam08794: Lipoprot_C 
Click on image for an interactive view with Cn3D
Lipoprotein GNA1870 C terminal like
GNA1870 is a surface exposed lipoprotein in Neisseria meningitidis that and is a potent antigen of Meningococcus. The structure of the C terminal domain consists of an anti-parallel beta barrel overlaid by a short alpha helical region.
Statistics
?
PSSM-Id: 400925
View PSSM: pfam08794
Aligned: 2 rows
Threshold Bit Score: 278.045
Threshold Setting Gi: 451928534
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YPV_A  98 QSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLPEgGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGK 177 Neisseria meningitidi...
Q5FAI5 132 QDHSAVVALRIEKINNPDKIDSLINQRSFLVSDLGGEHTAFNQLPD-GKAEYHGKAFSSDDADGKLTYTIDFAAKQGHGK 210 Neisseria gonorrhoeae...
2YPV_A 178 IEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ 252 Neisseria meningitidis MC58
Q5FAI5 211 IEHLKTPEQNVELASAELKADEKSHAVILGDTRYGGEEKGTYRLALFGDRAQEIAGSATVKIGEKVHEIGIADKQ 285 Neisseria gonorrhoeae FA 1090
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap