1L3E


Conserved Protein Domain Family
HIF-1a_CTAD

?
pfam08778: HIF-1a_CTAD 
HIF-1 alpha C terminal transactivation domain
Hypoxia inducible factor-1 alpha (HIF-1 alpha) is the regulatory subunit of the heterodimeric transcription factor HIF-1. It plays a key role in cellular response to low oxygen tension. This region corresponds to the C terminal transactivation domain.
Statistics
?
PSSM-Id: 400914
View PSSM: pfam08778
Aligned: 9 rows
Threshold Bit Score: 62.806
Threshold Setting Gi: 942147695
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1L3E_A         6 SGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQV 41 
NP_001012371 621 LTLPVLSGWECEVNAPLEHTSYLLQGTEIMAVLDQV 656 zebrafish
XP_018666946 699 GILPELSLHDCEVNAPLPGRGFFPVGVECVHALDEV 734 vase tunicate
XP_003758350 826 YLLPELTRYDCEVNVPVPGSSTLLQGSELLRALDQA 861 Tasmanian devil
XP_003962523 719 FSLPQLTRDDCEVNAPLQGRQFLLQGEELLRALDHV 754 torafugu
Q6EHI4       741 GGLPQLTRYDCEVNAPVQDRHHLLQGEELLRALDQV 776 zebrafish
XP_005996095 739 SVLPDITSYECGAASPLQSSRHLIQVEDLLRVLDQT 774 coelacanth
XP_005988922 766 SVLPVLNSLDCEVNAPVHGRSRLLQGNELLRVLDQA 801 coelacanth
CAG10537     546 FSLPQLTRDDCEVNAPLQGRQYLLQGEELGAPWTTS 581 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap