6A38,4FGV


Conserved Protein Domain Family
CRM1_C

?
pfam08767: CRM1_C 
Click on image for an interactive view with Cn3D
CRM1 C terminal
CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES). CRM1 forms a complex with the NES containing protein and the small GTPase Ran. This region forms an alpha helical structure formed by six helical hairpin motifs that are structurally similar to the HEAT repeat, but share little sequence similarity to the HEAT repeat.
Statistics
?
PSSM-Id: 370107
View PSSM: pfam08767
Aligned: 27 rows
Threshold Bit Score: 284.511
Threshold Setting Gi: 74630218
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6A38_C        665 QLGHIYYNMLQLYRAVSSMISAQVAAEGLIATK----TPKVRGLRTIKKEILKLVETYISKAR----------------- 723 
EDO26923       64 QLGRIYLDMLNVYRCLSENISMAISENGELVMK----QPLIRAMRTVKTEVLRLISTWVSKSN----------------- 122  starlet sea a...
Q23089        719 QLGNIYSDLLSLYKILSEKVSRAVTTAGEEALK----NPLVKTMRAVKREILILLSTFISKNG----------------- 777  Caenorhabditi...
Q7PMB7        691 QLGRIYLDMLNVYKIMSENITQAISLNGLSINN----QPLIKAMHVVKKETLTLISEWVWKSN----------------- 749  Anopheles gam...
EDX04246       28 QLGRIYLDMLNVYKITSENIIQAIEVNGVNVNN----QPLIKTMHVVKKETLNLISEWVSRSN----------------- 86   Drosophila si...
XP_001645797  709 QFEKILEDVVHLYGFSTKFIER-IENTSNNATEfednINILKLLRGIKRNILKLVKLLMRNVH----------------- 770  Vanderwaltozy...
Q7RP59        168 QLNLVFFDFLKIYQLYSKYINMEVEANGTKRIK----HAQFRNLFLMKREFLHLIETTIERSCyniqeleeallkreqkk 243  Plasmodium yo...
XP_001327132  673 QLRIIFNQLMEVYSRYSNLLQQFIGEPGYSETK------EANCFKRIKSKIVLIINDYILKTP----------------- 729  Trichomonas v...
A0D4D4        233 QLLPTYN---QIYLFYSQSIQQQVLAQGVVVMG----YYTVKKQRAVKKEILKLYATYFQNNDqe--------------- 290  Paramecium te...
EDO06672      765 QLMYIYPGITHLYNLYSCYIQNAVKAAGPGVLK----HNNINLMHLVRRSILHLLETYIGHLPnkiaktysepsvpiq-- 838  Babesia bovis
6A38_C        724 --------------------NLDD-VVKVLVEPLLNAVLEDYMN-NVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQS 781 
EDO26923      123 --------------------DPKL-VCDNFIPPLLDAVLGDYQR-NVPGAREPEVLSTMATFINKLEANVTENVSQIFDA 180  starlet sea a...
Q23089        778 --------------------DAKL-ILDSIVPPLFDAVLFDYQK-NVPQAREPKVLSLLSILVTQLGSLLCPQVPSILSA 835  Caenorhabditi...
Q7PMB7        750 --------------------DPKM-VMENFIPPLLEAVLFDYQRtKVPNAREPLVLSTMASIVNRLQAVITPEIPKIFDA 808  Anopheles gam...
EDX04246       87 --------------------DNQL-VMDNFIPPLLDAILLDYQRcKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDA 145  Drosophila si...
XP_001645797  771 --------------------NQEE-VLNFINSEFLDVVLTDFVK-SENEVKEVEVLSCMISLVSSTNVTISDYVDKIYDA 828  Vanderwaltozy...
Q7RP59        244 mkneidesidvhlptveeakQINFqMTSNILNVLLETILVDYRD-SNPHIKDAEVFSLLSTVFKKIENVTCPILPTVLNY 322  Plasmodium yo...
XP_001327132  730 --------------------DVES-VANELIEPISQTIILEYEN-SHPLGRVPEVLSLVTSMSNKMKKVFGEVLPNIYGP 787  Trichomonas v...
A0D4D4        291 ------------------llNKNYqLKNSLVIPICN-LLDEYSQ-SINEQKEPELLLTFKYMLEKFLAPIEDLVPLILKG 350  Paramecium te...
EDO06672      839 -----vdntvdmdqtedcnmNNYNeVLNMLIQSITSTVLVVYRN-CLAETRDHEVICVVTTLIEKLGNSGSHVLPQIFEQ 912  Babesia bovis
6A38_C        782 VFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIE 861 
EDO26923      181 VFECTLNMINKDFEEFPEHRTNFFLLLQAVVQHCFQALLKIPPEQFKLVLDSIVWAFKHTMRNVADTGLHILYSLLKNME 260  starlet sea a...
Q23089        836 VFQCSIDMINKDMEAFPEHRTNFFELVLSLVQECFPVFMEMPPEDLGTVIDAVVWAFQHTMRNVAEIGLDILKELLARVS 915  Caenorhabditi...
Q7PMB7        809 LFDCTLDMINKNFEDYPQHRTNFYELLQAVNMYCFKAFLSIPPEQFKLVFDSIVWAFKHTMRNVADTGLNILMQMLQNLE 888  Anopheles gam...
EDX04246      146 VFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLD 225  Drosophila si...
XP_001645797  829 IFFTTLNMIKGDLVEYPEHRIEFYKLLEQINKKYFNTLIKLSDQKFKLFIDTICWGIKHTNRDIEIRSLQIGLDLIHNIE 908  Vanderwaltozy...
Q7RP59        323 VLLPTIDMIKNDFSSYPEHREKFYNFLDACVRHCFDYLFTLDSEIFNTFIQSLLWAIKHEHPSVADHGLKITHQFLHNVI 402  Plasmodium yo...
XP_001327132  788 IFNETLAMIKDDFSIFPEFRVPFFKFVDNIVTNYISIMLSAPDQTFSDFIETIKLGCYHTIPEVCIISLSATEHLFKSIK 867  Trichomonas v...
A0D4D4        351 LFDATIRLISQDFNSYPDHRINFFEFLRSCVQYHLVALFNMPQDQFKLMIDCIVWAFKHQVPNLQELGLDVLYYILQQVN 430  Paramecium te...
EDO06672      913 IFDCTLDMVKMDFHSFPEHREYFYEMLQKCTKHCFDGLLLLPSERLRAYVMSLIWAFKHEHPSVAERGLTVVREFLNNLM 992  Babesia bovis
6A38_C        862 Rmg----------nVPFANEFHKNYFFIFVSETFFVLTDSD--HKSGFSKQALLLMKLISLVYDNKISVPLYQeaevpqg 929 
EDO26923      261 A-------------EEASQSFYQTYYITIVQHVLSVVTDTS--HTAGLTMHATILAHMFSLAESGKITQPLFNssea-qy 324  starlet sea a...
Q23089        916 Eq-----------dDKIAQPFYKRYYIDLLKHVLAVACDSSqvHVAGLTYYAEVLCALFRAPEF-SIKVPLNDanp---s 980  Caenorhabditi...
Q7PMB7        889 Qh------------PQAAQSFYQTYYTDILMQIFSVVTDTS--HTASLQNHATILAYMFSLVEAGRITVKLGPs------ 948  Anopheles gam...
EDX04246      226 Qh------------PGAAQSFYQTYFTDILMQIFSVVTDTS--HTAGLPNHAIILAYMFSLVENRKITVNLGPi------ 285  Drosophila si...
XP_001645797  909 Klg---------hnRVFSINFYRAHYLTLLSEVFYAMTDPD--HKAGFNRQSLLLMKLVSLIENGALSVSVFRnddmepr 977  Vanderwaltozy...
Q7RP59        403 Vk-----------kKEYLDEFCKAFYYIILNEVFKTLTDSF--HKSGFHYQTIILMNLLRLLEFEVINIPEAE------- 462  Plasmodium yo...
XP_001327132  868 Dt-----------nMNRYRQFLSNFYMDILVQVIKVTTDTY--HKFAFREEVNLIRKLL------STQTQQLN------- 921  Trichomonas v...
A0D4D4        431 Sd------------AVVANQFYSLYHLRLLKDILEILTDNL--HASGFKHQSQILMILFQVASNQQITAKLSNeq----v 492  Paramecium te...
EDO06672      993 LldrrndqspggqgMSAVLSFCRNYYYLLLKEILGVLTDTL--HKSGFRLQTEILRVLIRFLECGTVNDPSSE------- 1063 Babesia bovis
6A38_C        930 tSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQCK-D-------------------LVVFKGTLRDFLVQIKEVGG 989 
EDO26923      325 aSNQVCTACFVIDR-----SSLGEARTQDFSWGVFILGQ---------------------ARWFASA------KIKEYRS 372  starlet sea a...
Q23089        981 qPNIDYIYEHIGGNFQAHFDNMNQDQIRIIIKGFFSFNT-E-------------------ISSMRNHLRDFLIQIKEHNG 1040 Caenorhabditi...
Q7PMB7        949 dDNVLNIQEYVAMLLKSAFSHLTGNQIKIFVTGLFNLDQ-D-------------------VHAFKEHLRDFLIQIKEVTG 1008 Anopheles gam...
EDX04246      286 pDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDE-N-------------------VQAFKEHLRDFLIQIREATg 345  Drosophila si...
XP_001645797  978 iSNHTFLIEYMSNLINNAFTQLSREQIIVFLSALTKLYD-N-------------------KKRFNGILRDFLVQSKEFGG 1037 Vanderwaltozy...
Q7RP59        463 -ITKPHIIKHVQTFLTQSFENLNQKQIETFSVDMFNFCVeS-------------------PLTFRSFVRDLLISLKEFST 522  Plasmodium yo...
XP_001327132  922 -------GETIASAIQDLFPNRDYDSLVNYMSSLIANSN-N-------------------MVEFQHIFREFVISTTLFSR 974  Trichomonas v...
A0D4D4        493 gSNLEFISQYLVNSLYNAFPNVSKQQTELHIARMFQNLN-N-------------------AHNFRQELSDYLINLKQFQE 552  Paramecium te...
EDO06672     1064 -LTRVHVMKFLVELLGNSFITLNVKQVEAFVVDLFNFAGeTiaeqnesmmssglsitsgqPMRFQTHVKDFLLSLKEFAG 1142 Babesia bovis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap