1OP4


Conserved Protein Domain Family
Cadherin_pro

?
pfam08758: Cadherin_pro 
Click on image for an interactive view with Cn3D
Cadherin prodomain like
Cadherins are a family of proteins that mediate calcium dependent cell-cell adhesion. They are activated through cleavage of a prosequence in the late Golgi. This domain corresponds to the folded region of the prosequence, and is termed the prodomain. The prodomain shows structural resemblance to the cadherin domain, but lacks all the features known to be important for cadherin-cadherin interactions.
Statistics
?
PSSM-Id: 400897
View PSSM: pfam08758
Aligned: 16 rows
Threshold Bit Score: 104.724
Threshold Setting Gi: 223590198
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OP4_A     32 CKTGFPEDVYSAVLPKD-VHEGQPLLNVKFSNC-NRKRKVQYESSEPaDFKVDEDGTVYAVRSFPLTAEQAKFLIYAQDK 109 house mouse
NP_571895  29 CTPGFELEEFVFKVHRNhLHSGKRLGKVTFNNC-DGRTRTLFQSIDK-RFEINTDGTVTLKRQVTLHEGHKVFSVHAWDS 106 zebrafish
OCA37842   33 CQPGFSSADYTFSVNRReLERGRKLGKVNFVDC-TTRKHGLFDVGDS-RFRVLPDGTVLVKRHVKLHSKDTKFIVSTWDA 110 tropical clawed frog
Q08554     30 CQ------KVYLRVPSH-LQAETLVGKVNLEEClKSASLIR--SSDP-AFRILEDGSIYTTHDLILSSERKSFSIFLSDG 99  human
P55850     32 CK------KVTFHVPST-LEADKIIGRVSLKEClSSADGIM--PSDP-DFRVLDDGSVYPTRAVVLSDEKRSFTIQLSDS 101 house mouse
P39038     31 CKAGFSEEGYTALISPN-VLEGEKLLKVEFSSC-VGTKGMQYETNSL-DFKVGADGTVFATRELKIPSEQVAFTVTARER 107 house mouse
P08641     35 CQPGFAAETFSFSVPQDsVAAGRELGRVSFAAC-SGRPWAVYVPTDT-RFKVNGDGVVSTKRPLTLYGRKISFTIYAQDA 112 chicken
Q5RAX1     28 CHPGFDAESYTFTVPRRhLERGRVLGRVNFEDC-TGRQRTAYFSLDT-RFKVGTDGVITVKRPLRFHNPQIHFLVYAWDS 105 Sumatran orangutan
Q6R8F2     28 CIPGFGAESYTFTVPRRnLERGRVLGRVSFEGC-AGLPRTVYVSDDT-RFKVHTDGVLTVRRPVHLHRPELSFLVHAWDS 105 cattle
Q9R0T4     32 CRPGFSSEVYTFLVPERhLERGHILGRVKFEGC-TGRPRTAFFSEDS-RFKVSTDGVITVKRHLKLHKLETSFLVHAWDS 109 Norway rat
1OP4_A    110 ETQEk--WQVAVN 120 house mouse
NP_571895 107 SGMK---HTASVR 116 zebrafish
OCA37842  111 RGIK---HSTNIA 120 tropical clawed frog
Q08554    100 QRREq--QEIKVV 110 human
P55850    102 KMQTq--KEIPVI 112 house mouse
P39038    108 QSAEqwaAMVRLL 120 house mouse
P08641    113 MGKR---HSARVT 122 chicken
Q5RAX1    106 TYRK---FSTKVT 115 Sumatran orangutan
Q6R8F2    106 THRK---LSTKVT 115 cattle
Q9R0T4    110 SYRK---LSTKVT 119 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap