1FLC


Conserved Protein Domain Family
Hema_stalk

?
pfam08720: Hema_stalk 
Click on image for an interactive view with Cn3D
Influenza C hemagglutinin stalk
This domain corresponds to the stalk segment of hemagglutinin in influenza C virus. It forms a coiled coil structure.
Statistics
?
PSSM-Id: 72144
View PSSM: pfam08720
Aligned: 3 rows
Threshold Bit Score: 324.68
Threshold Setting Gi: 7245543
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FLC_B   1 IFGIDDLIIGVLFVAIVETGIGGYLLGSRKESGGGVTKESAEKGFEKIGNDIQILKSSINIAIEKLNDRISHDEQAIRDL 80 
P68762 447 IFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLNDRISHDEQAIRDL 526 Influenza C virus (C/...
P68762 447 IFGIDDLIIGLLFVAIVEAGIGGYLLGSRKVSGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLNDRISHDEQAIRDL 526 Influenza C virus (C/...
1FLC_B  81 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWIIDNNICDQSCQNFIFKFNETA 160
P68762 527 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIFKFNETA 606 Influenza C virus (C/...
P68762 527 TLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWVIDNNICDQSCQNFIFKFNETA 606 Influenza C virus (C/...
1FLC_B 161 PVPTIPPLDTKIDLQ 175
P68762 607 PVPTIPPLDTKIDLQ 621 Influenza C virus (C/Ann Arbor/1/50)
P68762 607 PVPTIPPLDTKIDLQ 621 Influenza C virus (C/Ann Arbor/1/50)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap