4GNK,1JAD


Conserved Protein Domain Family
PLC-beta_C

?
pfam08703: PLC-beta_C 
PLC-beta C terminal
This domain corresponds to the alpha helical C terminal domain of phospholipase C beta.
Statistics
?
PSSM-Id: 400858
View PSSM: pfam08703
Aligned: 15 rows
Threshold Bit Score: 164.472
Threshold Setting Gi: 946739975
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4GNK_B       1030 KRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQFKRLKEMNEREKKELQKILDRKRHNSISE 1109
XP_001381023  982 GRIRELKEKLEMELYQQGEEQYESIMKRKEAHGSELMDKVLKLAQEKQAAELKALKESADGNTKEMKKKLEVKRLERIQA 1061 gray short-ta...
P51432       1029 KQYREFQNRQVQSLLELREAQADVETKRKLEHLRQAHQRLKEVVLDTHTTQFKRLKELNEREKKELQKILDRKRNNSISE 1108 house mouse
XP_014324450  977 KQKAQLWENNMQELLELRQGLYLQEKQMQLQHLAEEHEKLKLTVTEYQELHTKKLTDICSKEKKEIQKVLERKRIQSLLE 1056 southern plat...
XP_005046731  981 hcLVELRERLEMDLIHLGEEHHNRIRRKKEQHATEQVARILELAREKQAAELRVLRDTSESNIKDIKKRMEAKRVERVQA 1060 Collared flyc...
XP_016851418  981 NRVLELKDKLEEELLQLGEEQYDGIRKKKEQHATEHIAKIIELARDKQAAELKALKESCESDTKEMKKKLEAKRLDKVQT 1060 green anole
O89040        976 PRVQDLKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAREKQAAELKSFKETSETDTKEMKKKLEAKRLERIQA 1055 Norway rat
1JAD_A         74 SQVVELKERLEXELIHLGEEYHDGIRRRKEQHATEQTAKITELAREKQIAELKALKESSESNIKDIKKKLEAKRLDRIQV 153 
NP_001116245 1014 KQMEQFREEHMQKLLVLRQGQLQMEKEVKQFHLKEANQKLKDIAIECQAAQIKKLKDVCDKEKKELQKMLDRKRLNSIVE 1093 zebrafish
KAE8607433    539 QKFMDMQLDQQKRLLELREIQHEQERKLKHSHLLQAVQKLQEVAISCHSTQLKKLKEINEKEKKELQKILDRKRHNSITE 618  tropical claw...
4GNK_B       1110 AKMRDKHK-KEAELT-EINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQE 1187
XP_001381023 1062 MSKITSDKmAQERLKrEINNSHIQEVVHIIKQMTETLERHQERLEEKQAACLEQIREKGKQFQQEALSEYEERMKGLEAK 1141 gray short-ta...
P51432       1109 AKTREKHK-KEVELT-EINRRHITESVNSIRRLEEAQKQRHERLVAGQQQVLQQLEEEEPKLLAQLTQECQEQRERLPQE 1186 house mouse
XP_014324450 1057 AKKKDPDL----KLS-DFNKKHINDCVEIFRKLEKLQSMRKEKFLLKHLEMTQQMESLLTQLESQLNEKLEEEYSQLPRE 1131 southern plat...
XP_005046731 1061 MLRNTSDKaAQERLKkEINNSHIQEVVQTVKRMTEKTGRFQQKLEEKQAASLQSIKERESQLQQQVRVEYEERLRALNTE 1140 Collared flyc...
XP_016851418 1061 MTKNTTDKsTQERLKkEINNAHIQEVVQTVKQMNEKQNRFQQILEAKQAACIEKIKEKENQLQEEAFTEYEEKVKGLSAE 1140 green anole
O89040       1056 MTKVTTDKvAQERLKrEINNSHIQEVVQAVKQMTETLERHQEKLEEKQTACLEQIQAMEKQFQEKALAEYEAKMKGLEAE 1135 Norway rat
1JAD_A        154 XXRSTSDKaAQERLKkEINNSHIQEVVQTIKLLTEKTARYQQKLEEKQAENLRAIQEKEGQLQQEAVAEYEEKLKTLTVE 233 
NP_001116245 1094 ARKAE----KEIDVN-EINRKHIQESVSLIRQLEVSQGKRQEKLKALHKDILQKIEEEIPMNQARLTRDFEAELKRLPEE 1168 zebrafish
KAE8607433    619 AKSRERQK-KDVELT-EINRRHINESVSSIRRLEEAQKRRQEKLQAAHQETLQRIKDEEPKLQAQLDESCQAEFRQLPQE 696  tropical claw...
4GNK_B       1188 IRRSLLGEMPEGLGDG 1203
XP_001381023 1142 VKEAVKCCLS--FPQD 1155 gray short-tailed opossum
P51432       1187 IRRCLLGETAEGLGDG 1202 house mouse
XP_014324450 1132 ISQHLPSDLQNKGacm 1147 southern platyfish
XP_005046731 1141 VQEMVKNYIKASFPGE 1156 Collared flycatcher
XP_016851418 1141 VQDLVKTCVKVCFPLE 1156 green anole
O89040       1136 VKESMRACFKACFPTE 1151 Norway rat
1JAD_A        234 VQEXVKNYXKEVFPDG 249 
NP_001116245 1169 ISQYLQELESKGSRKD 1184 zebrafish
KAE8607433    697 VRRYLQEDGWVGSGSG 712  tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap