Conserved Protein Domain Family
ASD2

?
pfam08687: ASD2 
Apx/Shroom domain ASD2
This region is found in the actin binding protein Shroom which mediates apical contriction in epithelial cells and is required for neural tube closure.
Statistics
?
PSSM-Id: 400845
View PSSM: pfam08687
Aligned: 53 rows
Threshold Bit Score: 228.667
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_008208250 1557 DLANQLGPDDK-LLPILVPIPEHKKSTDYVVDLFrVEAALHprprpRLTINEEStsidaadneseedkkidsipstpvtP 1635 jewel wasp
XP_005335822  547 ELVQELARLDPsLSDTLTSQPCPEPPLGLLDGLIpLAEVWAamkpgCGEA------------------------------ 596  thirteen-line...
EHB00064      345 ELVQELARLDPsLSDTLASEPSPEPPPGLLDGLIpLTEAQAtvwpaFREP------------------------------ 394  naked mole-rat
XP_010588279  568 ELVQELARLDPsLSDILAPHPSPEPPLDVLDGLIpLAEVWAamrpaCGEA------------------------------ 617  African savan...
XP_015327683  535 ELVQELARLDPsQSDTFTSYPSPEPALGLLDGLIpLAEVWAamrpaCREA------------------------------ 584  cattle
XP_004745125  563 ELVQELARLDPsLGDTLTSCPSPEPPLDLLDGLIpLAEVWAamrplCGEA------------------------------ 612  domestic ferret
XP_016809283  544 ELVQELARLDPsLCDPLASQPSPEPPLGLLDGLIpLAEVRAamwpaCGEA------------------------------ 593  chimpanzee
XP_012664679  529 ELVQELARLNPsLSDTLAFQPSPEPPLGLLDGLIpLADVWAamrpaCGEA------------------------------ 578  small-eared g...
XP_028906384 1223 ELALEIIAEDQsLADVLSPYPARKTALDLMEGLF-PESFTTlgrgdRKRRA----------------------------- 1272 platypus
KAE8614573   1159 ELVKDIVAKDKsLMNCLQPISVRESAMDLMKSLF-PMDFTEaeksrTRGLLRKD-------------------------N 1212 tropical claw...
XP_008208250 1636 SAPDSSSSSSSSPLSASSVYFTTSESKARFLT--RYSQDvvaEQVTTTPATpSIKPTTpd-slDLRQKKEELMIRLDKKL 1712 jewel wasp
XP_005335822  597 ----GEEGPGTSEPGSYQFNFTQLLPTSQEMT--RPENSpscPMPDCPNAQ-T---SNn----SVQAKKVELAGLLQEML 662  thirteen-line...
EHB00064      395 --G--EEVASTSEPGSCLFSFTQLLPASQ-ET--RPENAtllPVPNQPCGQgLPAQNV-----SIQVKKVELAGLLQKML 462  naked mole-rat
XP_010588279  618 --G--EEAGGTSEPQSCLPSSAQLLTTSQDET--RAENFtmcPVPEQPYGQgPPEPTN-----SIQAKKAELADLLQKML 686  African savan...
XP_015327683  585 --G--EEAAGNSEPGSYLLNSTQHLPTSQEET--RPENLtthVAPDQPCDQdVPKPNN-----SIQAKKAELADLLQKML 653  cattle
XP_004745125  613 --G--KKAGGSPEPGFYLFSSSQLLSTSLEET--RFENHtthPVPDQACGQgLPQPNS-----SIQAKKMELADLLQKML 681  domestic ferret
XP_016809283  594 --G--EEAASTFEPGSYQFSFTQLLPAPQEET--RLENPathPVLDQPCGQgLPAPNN-----SIQGKKVELAARLQKML 662  chimpanzee
XP_012664679  579 --G--EEAAGTSQPGSYQFSFTQFPPTSQEEE--ILKNSathPVPDQPHGQgFPEPNN-----SIQAKKVELASLLQKML 647  small-eared g...
XP_028906384 1273 -RLGEEVPSTAGGEQSPDSPVTVMVADAEQDPapEADPApsdPQRVQLPSKgAAADPD-----GITAKKAELAGLLRDKL 1346 platypus
KAE8614573   1213 SETLRKNNSDLESSSKLPSKITVMLQKSSARR------------------------PDgesldDITSKKMELLSNIGSKL 1268 tropical claw...
XP_008208250 1713 VVLRAEQEAVREEGEVNEALGSRVQARIAALAKPAEASKYRLHVEEVGKITSLLLGLSGRLARAENALYGMPADHP--ER 1790 jewel wasp
XP_005335822  663 QDLHIQEERLQDAAQEWTRRRLALESAVGQACAPRELERFSRFLADLERVLGLLLLLGSRLARVHHALARMGSDGDpdER 742  thirteen-line...
EHB00064      463 QDLHARQEQLQGVAQAWARRRAALEAAVAQACAPRELERVSRFMADLERVLGLLLLLGSRLARVHRALARVGSDGDpeER 542  naked mole-rat
XP_010588279  687 RDLQAEQERLRGAAQACARRRAALESAMGQACAPQELERFSRFMADLERVLGLLLLLGSRLARVRCALVRAGSNGDpdER 766  African savan...
XP_015327683  654 RDLQAEQKQLQGAAQAWARRGAALEAAVGQACAPHELERFSRFMADLERVLGLLLLLGSRLARVHRALARVGADSDpeEQ 733  cattle
XP_004745125  682 RNLEAEQEQLHGAAQAWARRGAALEAVVGQSCSPRDLERFNRFMADLERVLGLLLLLGSRLARVRRALARDGVDCDpdEQ 761  domestic ferret
XP_016809283  663 QDLHTEQERLQGEAQAWARRQAALEAAVRQACAPQELERFSRFMADLERVLGLLLLLGSRLARVRRALARAASDSDpdEQ 742  chimpanzee
XP_012664679  648 WGLHSEQERLQEAAQTLARSQAALEVVVNQACEPRELERFSRFMADLERVLGLLLLLGSRLARVRRALAWAGADGDpdER 727  small-eared g...
XP_028906384 1347 HGLREERRSVLAAAKACARWGTELDELVRHTCKPNEHERYAQFIGDLEKVVSLLLCLSSRLARVQNALARVDESTDaeER 1426 platypus
KAE8614573   1269 EDLCEQKEILLADNSKNTTHGNNIQALVKELCKPNEFERYMMFIGDLEKVVSLLFSLSTRLTRVENALSKVDENTDaeEM 1348 tropical claw...
XP_008208250 1791 KILESKRDKLMDQLEEAKILKGNIDRRSVNVSAILSKYLSDEEFADYQHFINMKAKLIVDGREIQDKVKLGEEQLAALKE 1870 jewel wasp
XP_005335822  743 DSLLQRLGLLQRQQEDAKELKEHVARRERALREVLARALSAEELCSYSELLVGKATLLTQQRCLEEHVRLFQNQLDTLGS 822  thirteen-line...
EHB00064      543 ASLLQRLGLLRRQQEDARELKEHVSRRERALREVLARALPAEEVRAYCTLLADKAAVLAQQRSLDERVRLLQDQLDAVRS 622  naked mole-rat
XP_010588279  767 ASLLQRLRLLQQQQEDAKELKEHVARRERVLREVLMRTLPVEELHAYCALLAGKAAVLAQQRSLDERVRLLQDQLDAVKS 846  African savan...
XP_015327683  734 ASLLQRLGLLQRQEKDAKELKQHVARRERALRELLARALPAEELSAYRTLLAGKAAVLAQQRSLDERVRLIQDQLDAVRN 813  cattle
XP_004745125  762 ASLLQRLGLLQRQQEDAKELKEHVARRERALREVLVRALPTEELSAYRALLAGKAAVLAQQRSLDERARLLQDQLDAIRS 841  domestic ferret
XP_016809283  743 ASLLQRLRLLQRQEEDAKELKEHVARRERAVREVLVRALPVEELRVYCALLAGKAAVLAQQRNLDERIRLLQDQLDAIRD 822  chimpanzee
XP_012664679  728 ASLLRRLELLQRQQEDAKELKEHVARRERALREVLARALPVEELRAYSALLAGKAAVLAQQRSLDERVRFLQDQLDVVSS 807  small-eared g...
XP_028906384 1427 QSLNDRLSLLSRQREDAKDLKENLDRRERVVCGILSKQLPPAQLQDYRDFVRTKASLLMEQKGLDERIMFCEEQLESLQS 1506 platypus
KAE8614573   1349 QSLKERHNLLSSQREDAKDLKANLDRREQVVTGILVKYLNEEQLQDYKHFVRLKTSLLIEQKNLEEKIKLYEEQLESIHD 1428 tropical claw...
XP_008208250 1871 A 1871 jewel wasp
XP_005335822  823 N 823  thirteen-lined ground squirrel
EHB00064      623 D 623  naked mole-rat
XP_010588279  847 D 847  African savanna elephant
XP_015327683  814 D 814  cattle
XP_004745125  842 D 842  domestic ferret
XP_016809283  823 D 823  chimpanzee
XP_012664679  808 D 808  small-eared galago
XP_028906384 1507 S 1507 platypus
KAE8614573   1429 S 1429 tropical clawed frog
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap