1S7Z


Conserved Protein Domain Family
ocr

?
pfam08684: ocr 
Click on image for an interactive view with Cn3D
DNA mimic ocr
The structure of an ocr protein from bacteriophage T7 has shown that this protein mimics the size and shape of a bent DNA molecule. ocr has also been shown to be an inhibitor of the complex type I DNA restriction enzymes.
Statistics
?
PSSM-Id: 400842
View PSSM: pfam08684
Aligned: 2 rows
Threshold Bit Score: 155.604
Threshold Setting Gi: 46015746
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1S7Z_A   4 SNXTYNNVFDHAYEXLKENIRYDDIRDTDDLHDAIHXAADNAVPHYYADIFSVXASEGIDLEFEDSGLXPDTKDVIRILQ 83  Escherichia phage T7
Q7Y5R4   4 SNMTYSDVYNHAYGLLKEYIRYDDVRNEDDLSDKIHEAAGNAVPHWYADIFSVMASDGIDLEFDDSGLMPDTKDVTYILQ 83  Salmonella virus SP6
1S7Z_A  84 ARIYEQLTIDLWEDAEDLLN 103 Escherichia phage T7
Q7Y5R4  84 ARIHEQLTIDLYGDAEDLLN 103 Salmonella virus SP6
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap