2FPN


Conserved Protein Domain Family
DUF1779

?
pfam08680: DUF1779 
Click on image for an interactive view with Cn3D
TATA-box binding
TATA-box_bdg is a family of bacterial proteins. YwmB from Bacillus subtilis contains a circularly permuted TATA-box binding protein-like fold. Jian-Xiang Liu, Qi Xie, Jun Lin. Protein Structural Data Mining and Evolutionary Bioinformatic Analysis on Domains of TATA-box Binding Protein-like Fold. Life Science Journal 2014; 11(2): 298-302 (not yet in PubMed 27-02-2014).
Statistics
?
PSSM-Id: 400839
View PSSM: pfam08680
Aligned: 30 rows
Threshold Bit Score: 112.42
Threshold Setting Gi: 81745359
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FPN_A          31 LTE--KEFYQKVQRLKQEyrqydwVIAREDK-XIKAIGTYTDKKNRTSFRLQLVTT------LKKHNPTSYLLYEqxsle 101 Bacillus subt...
WP_014966424    63 IEDlrQTTEDISKSIGLI------KINSEEIeETNMNQVTTYAQDDSERNITIVAYsf--fdEESQKGETTIFLDi---- 130 Gottschalkia ...
jgi:Ccel_0279   66 VSElsKVCEDVFKTLEIS------QYSKNTNsSDNLAKKEMHGTTADGVKVSAMASiv---gNKSGNRDKYITID----- 131 Ruminiclostri...
jgi:Cthe_2614   62 fEElsKIVDNLAKDMNVEnn---eLYSRRLIgNDMIDKIEVIGTIGRGRMVNICAQsa---rNKKDGEKSYISLSl---- 131 Hungateiclost...
jgi:Clocl_0306  65 MEKllKLADQLEMDLSVVkn---nTYTKQYVkEHSFDKLEIKGICADGKRVDIAAQq-----CKDNSQKSNISVNv---- 132 Hungateiclost...
CCP27067        60 FTQmqQYQDEIMKIFNAEk----eNFDFTEEnNETYRILNTEGKLDSDTFLQIIIQsvilpaEYEKDPQTYLTIS----- 130 Tepidanaeroba...
Q18CL2          62 NKEfhNIFIEIINNLKLDk-----KGINWNQkGSGDKIQLCATIKGSDKEISIk-------gINKNNKESYIVVDi---- 125 Clostridioide...
WP_012811967    92 ETQlaALGAQVVQELGLA------NVKTQAAqLVNETYWRAVGVWPSGTRAEVVLTsfpgapSGAGDGQPETVMTvt--a 163 Alicyclobacil...
jgi:Btus_3217   66 TDQlkRMAARLNATLQLR------DTREWVYdQGDQRVFQLQGWWPGGTSGVLVITs----lKTDSQPDTTLVLRv---- 131 Kyrpidia tusc...
jgi:Mahau_1783  63 GTQirQLGNDVAKAIDIIk----sPYRCDVVdDEAQHWIKIYS-----DNVSVSVRm----sDDVDDTQSYITVNa---- 125 Mahella austr...
2FPN_A         102 tPDSWND-----TYEQFERETLGIfQEKVVIFTCLNGHLDDNXNIV-LQKKANQLLNEFQARSVEHVVEPNFVSISAFTD 175 Bacillus subt...
WP_014966424   131 -NETNKYeeldeMTSKLSHTLKKY-DTNVEITSCIVGTFEGKLESDyKMGKIEQIVNITKGKPVESLIDPSITSVSLYSE 208 Gottschalkia ...
jgi:Ccel_0279  132 -ATEAGDgkallLREKIEGVFTKY-RLKAEINSCITGTYEGDLSDNqLESICRKILNESSAKKIDSFRQQNEISVSAFSP 209 Ruminiclostri...
jgi:Cthe_2614  132 -TLGPEEfelerIHDNLINVLDKY-KIEPELNICITGYFEGRMDYKnLNKVSKKILKSADAKKVNGIAENNLISVSAFAP 209 Hungateiclost...
jgi:Clocl_0306 133 -INRMGAldindTVNAIKERFKSL-KLKPKINTCIIGCFDGKLDYEeMNRISENILKCAKAKKIESLYDNNLISISAYSP 210 Hungateiclost...
CCP27067       131 -ISSRNLekyndFVKKVSKTINSL-GGQSKITSCVTGTFNGKLDEAkQDKLVETIASYFEIINTEKIQDKYNFSIIGFSP 208 Tepidanaeroba...
Q18CL2         126 -LDNKVYkhkevIYSNVENVLNKY-SSQVDVSACIVGEYTKRLQNNkYDDILQKILYNMSAKQIDEVKDVNFLSITAYSK 203 Clostridioide...
WP_012811967   164 sSSNLTEgqfssQYDQVERTVASV-NGTPQMSAYIAGFKPSEVSEAeADGMAIAALRAVGAAAVEGIRTPLETSLSGYSA 242 Alicyclobacil...
jgi:Btus_3217  132 eHTGPGTdglaaAYDRVKQTVASA-GQTPRIDSCLYGSLSDRMSETeRQNRIAQALASVRAKEVEALRTPLVTSVSAYSP 210 Kyrpidia tusc...
jgi:Mahau_1783 126 -CGDIQNaklddIVKSIEKGLKQY-SENIHMSLALKGYIKGEARQQtLDRLNSVAFKSLNAQYVEGIKSEKLHSTTAYSP 203 Mahella austr...
2FPN_A         176 EWEEYI-XtSKHKXNLQIALRSAGXGGKHTVTVGTP 210 Bacillus subtilis
WP_014966424   209 YIDRYIfS-GDKKMNLNVSMRYNEYENKTYMLIGTP 243 Gottschalkia acidurici
jgi:Ccel_0279  210 LISDKLrV-GGKNVNLGIAFRYNKLENRTYLWVATP 244 Ruminiclostridium cellulolyticum H10
jgi:Cthe_2614  210 GIDNSIlV-NGKKVNMNLAIRYNSYEDRTYIWLATP 244 Hungateiclostridium thermocellum ATCC 27405
jgi:Clocl_0306 211 CIDNNIeV-KGKRININIALRYNAYEDKTYIWLATP 245 Hungateiclostridium clariflavum DSM 19732
CCP27067       209 LLSEGIqI-LGKNYNIHIAIRYNSDEDITYIWIGTP 243 Tepidanaerobacter acetatoxydans Re1
Q18CL2         204 VLNDYElEyLGEKINLNIGIKYNEDDGKTLIYIATP 239 Clostridioides difficile 630
WP_012811967   243 RAPVYVlAgDHRRVNVQVAVHDDSFRHGTDVYVGSP 278 Alicyclobacillus acidocaldarius
jgi:Btus_3217  211 QTKEYIlT-GGKKMNLQIAVHDDAYGNKTRVVVGTP 245 Kyrpidia tusciae DSM 2912
jgi:Mahau_1783 204 SIRHYVdI-KGRKANMQLAARYNSYDNRTDVWLGMP 238 Mahella australiensis 50-1 BON
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap