1WHV


Conserved Protein Domain Family
RNA_bind

?
pfam08675: RNA_bind 
RNA binding domain
This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN).
Statistics
?
PSSM-Id: 400835
View PSSM: pfam08675
Aligned: 11 rows
Threshold Bit Score: 121.688
Threshold Setting Gi: 159163364
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WHV_A         9 PDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVQIAVNTS-KYAESY--RIQTYAEY 83 
O95453       438 PDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDDTSAFVSLSQPEQVKIAVNTS-KYAESY--RIQTYAEY 512 human
EDO42514     485 PDLKPARDHVFFLTFPSSWKYVDILDLFSPFGFVYVSWLNDVSAYVSLAVRNKSKAVLDALdVYDAPY--TITSYAEY 560 starlet sea anemone
Q7PT32       444 KEPTQTREHIFYATFPETWRTGDIQNKFKPFGPVHVSWLDNTSAFVALHNRSAASSVLKMI-GYHSGF--KVYNFAQF 518 Anopheles gambiae...
ETN61263     439 KEPTHSREHIFYVTFPETWRTGDIVGKFKPFGSVHISWLNNTSAFVSLHNRIASSSVLKTI-GYHPGF--AVHSFAQF 513 Anopheles darlingi
EDS26303     395 KEPSFSRDHIFYITFPENWRNVDILCRFRNYGQVFISWVNETSAFVTLHNRDHAAAVLKTIdKSNAAF--TICTLNQF 470 southern house mo...
Q17L86       426 KEPSFSREHVFFVSFPETWRQSDIVNRFRNYGQVYVNWVNSNSAFVTLHNRDYASHVIKTIdK--ASI--TICTLTQF 499 yellow fever mosq...
XP_008201921 422 NDPNPSREHVFHVTFPKQWKLSDLTSLFSPYGGAYVAWLSDTTAYAALHRRDQVSAVVQNL-FKSTHY--SLKKYRDY 496 jewel wasp
EGI63777     460 KDPNPSREHVFHLTFPKEWKHTDIIQLFIPFGGGYISWLSDTSAYVGLYRRDQAGVAMTSL-SKETVY--KIQTYTEY 534 Panamanian leafcu...
EFN61018     422 KDPNPSRDHVFHITFPKEWKHTDISQLFSPFGGGYISWLSDTSAYIGLYRRDQASVVMQAL-AKQTIC--KIQKYSNH 496 Florida carpenter...
EFX66955     441 PDLEPSREHIFYVTFPKSWKLHDIFHLFSVHGTVRVDWTGDTSAFVTLHRKENCHFVLSAMnESTLPVgcSVISYETY 518 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap