Conserved Protein Domain Family
PglZ

?
pfam08665: PglZ 
PglZ domain
This family is a member of the Alkaline phosphatase clan.
Statistics
?
PSSM-Id: 400825
View PSSM: pfam08665
Aligned: 10 rows
Threshold Bit Score: 194.482
Threshold Setting Gi: 146233326
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q7MVV4        231 EKVFFILIDNFRQDQWESVKSMLSEFYTFEEDM----YLSILPTATQYARNAIFSGLMPLQIEKMFPDLWVDEESEEGKN 306 Porphyromonas ...
Q5P0R1        485 KRVFVVISDAFRFEAAEELVQQLNSKSRFKAALs--sQLGVLPSYTTLGMAALLPHHSLAYKINSNLDVLADGQPVSTLE 562 Aromatoleum ar...
Q8ZK15        474 KRVFVIISDALRYEVAEELGNQINTEKRFTAELr--sQLGVLPSYTQLGMAALLPHDEICYQPGSGDIVYADGLSTSGTP 551 Salmonella ent...
Q2W5M5        475 RRVFVIISDALRYEAAKELVDVLNGTYRIQAEIq--pMLGVLPSYTALGMAALLPHSKISYS--DKGDVLVDGQSSAA-G 549 Magnetospirill...
Q72AH5        438 NKVCVIISDAMRYEIGDELLSLIRQEDRYSAELe--pALSMLPSYTQLGMAALLPNKALAIADNETGTVLVDGQSSQGTA 515 Desulfovibrio ...
jgi:Exig_0316 462 ERVFVIVSDAMRYEVGLELIDLLNFETTGICEMq--sMLGVVPSVTKLGMAALLPHRKLDFD--ENGRVLVDGKDSAGLE 537 Exiguobacteriu...
Q8TNC5        496 SKVAVIVSDALRYEAAAELFETLNKDTWGIPELs--yMAGVLPSYTKLGMASLLPHNALEYR---GREIFVDGISSEGLE 570 Methanosarcina...
Q3A8U0        461 ERVFVIISDALRFEAGRELAEMLNTERRGTTEIs--aMQGVLPSYTKLGMAALLPHKKIEID--SDYEVFVDGISVEGTD 536 Carboxydotherm...
Q2RKS0        260 AKKVLICMDGMGFQEWCCLKQYLAGRGIDSFSVt--aVFTLLPTLTRVSRRALFCGRP-------ALGDRVEEERGFLQF 330 Moorella therm...
tigr:DNO_0176 401 SRAALIVVDGLALDQWVTIRQLLQKQDA-NLVMresaTFAWIPTLTSVSRQSIFSGKPPLYFPSSINSTNSEEKLWKQFW 479 Dichelobacter ...
Q7MVV4        307 LNEEPMIRTLieryrkHYSFSYNKVYETKFGERLLgqirSLSQNQLNVIVLNFVDMMSHartdsKMIRELASNEAAYRSL 386 Porphyromonas ...
Q5P0R1        563 QRNAHLAKYE------GLAIKADELLTLGKDKGRT----LVRERRVIYVYHDHIDALGD-----KQATEGMTFRAVDEAI 627 Aromatoleum ar...
Q8ZK15        552 NRDTILKKYK------GMAVKSDDLLKWKNQQGRD----LIRDYEVVYIWHNTIDAMGD-----SASTEEKTFEACRNAV 616 Salmonella ent...
Q2W5M5        550 NRSNILATKK------GVAVKADDLKDMKKDAGRE----FVKPYEVVYVYHNTIDAIGD-----SGSTEGKTFEAVRQAL 614 Magnetospirill...
Q72AH5        516 NRIKILGQAIsh---rATACKADELMAMKGDDCRA----LVRDHDVIYVYHNRIDATGD-----KRESEERVFEAVEETL 583 Desulfovibrio ...
jgi:Exig_0316 538 NRKKIIESYVe----dSLAIHFQDMLAMNKAARRE----TFKGKRVVYIYHDTIDAMGD-----KASTEIYTFNAVETSL 604 Exiguobacteriu...
Q8TNC5        571 KRNKILQSKYe----dSLAFNYEDFMRYSREEARE----FIKGKRVLYIYHNKIDSTGD-----KQSSENNVFSAVEETI 637 Methanosarcina...
Q3A8U0        537 NRNMILQNHVn----kSIAVQYKDIIDLRRDDLRK----LLGGKELIYIYHNSIDARGD-----HYLTEREVFDAVAEAF 603 Carboxydotherm...
Q2RKS0        331 VREKWLE---------GERRQAGVFMNIDGRWRHE-----YLDFDYLALACNLVDDLAH-----ASVSVQDSKELMQKSL 391 Moorella therm...
tigr:DNO_0176 480 EGHGLSR---------LDVAYQRGLGDGDAAGVLDsa-iHPGKTKVVGLVVDKVDKIMH--------GMQLGSAGMHNQI 541 Dichelobacter ...
Q7MVV4        387 TkswfkhsTTYNLFRSIAEM--GYKVVLTTDHGTIQVKNPV 425 Porphyromonas gingivalis
Q5P0R1        628 G-------QLSQLVSFIINSlnGSTVLVTADHGFIYQEAPL 661 Aromatoleum aromaticum EbN1
Q8ZK15        617 V-------ELKDLVTRVINRlhGTRIIVTADHGFLFQQQPL 650 Salmonella enterica subsp. enterica serovar Typhimurium
Q2W5M5        615 N-------ELSDLIRMIMNNlnGTYIYVTADHGFLFQETAL 648 Magnetospirillum magneticum AMB-1
Q72AH5        584 Q-------ELIRLIKKLTGAn-ANNLLVTSDHGFIYQNRAI 616 Desulfovibrio vulgaris str. Hildenborough
jgi:Exig_0316 605 N-------QLKALVKMIRDDlgGTNIYVTADHGFLYQRDAL 638 Exiguobacterium sibiricum 255-15
Q8TNC5        638 V-------EIKKLVKYLSDRlnTTNIIVTADHGFLYRRDDM 671 Methanosarcina acetivorans
Q3A8U0        604 E-------QLKSLVNNLVNHlsATHIYIISDHGFVYKRGSV 637 Carboxydothermus hydrogenoformans Z-2901
Q2RKS0        392 Imhl-dgsGFAETMQRLLEE--GYRVYLVADHGSVWCRGNG 429 Moorella thermoacetica ATCC 39073
tigr:DNO_0176 542 Kqwc-hagFLSAMVGQLLDY--GYEVWLTADHGNIQCEGKg 579 Dichelobacter nodosus VCS1703A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap