Conserved Protein Domain Family
DASH_Dad1

?
pfam08649: DASH_Dad1 
DASH complex subunit Dad1
The DASH complex is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro. Components of the DASH complex, including Dam1, Duo1, Spc34, Dad1 and Ask1, are essential and connect the centromere to the plus end of spindle microtubules. Throughout the cell cycle Dad1 remains bound to kinetochores throughout the cell cycle and its association is dependent on the Mis6 and Mal2.
Statistics
?
PSSM-Id: 400811
View PSSM: pfam08649
Aligned: 50 rows
Threshold Bit Score: 68.3861
Threshold Setting Gi: 328854543
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q0UHY2        20 YFEQQREMLVTEIAQSLELVLQNINKLNRSLEEVTQVGNEFAPVESLWSHFENVM 74  Parastagonospora nodorum SN15
P87297        24 DFERRRRLLTLQISKSMNEVVNLMSALNKNLESINGVGKEFENVASLWKEFQNSV 78  Schizosaccharomyces pombe 972h-
XP_002173015  20 TFERKRRQLILQISNNMHEIVNLLDVLNKNLESVNGVGKEFDKVASLWMSFHESV 74  Schizosaccharomyces japonicus yFS275
Q6CER3        15 YFERQRDQYIKNISASMEDVLNNLNALNRSLEHTVGLSQKSEELAEMWSHFYNTV 69  Yarrowia lipolytica CLIB122
Q12248        19 YFIEQRNIVLQEINETMNSILNGLNGLNISLESSIAVGREFQSVSDLWKTLYDGL 73  Saccharomyces cerevisiae S288C
XP_004182358   9 EFIRQRAAIISEINKTMDSIINALTGVNISLESSNALRTQFESVSDLWKVFYDGL 63  Tetrapisispora blattae CBS 6284
XP_002999530  12 DFIEQRDVLLQEVNELVASILNGLNDLNISLESSISVGKEFEKVSTLWKSFYDGL 66  [Candida] glabrata
Q75E95        19 YFVEQRDLLLQEITSTLDSILNNLNGLNISLENSIAVGKEFESVSELWKVFYDGL 73  Eremothecium gossypii ATCC 10895
XP_001645316  23 LFMEKRDLILQDITNTMDSILNNLNGLNISLESSIALGSQFESVCDLWKTFYTSA 77  Vanderwaltozyma polyspora DSM 70294
Q6CW48        14 YFIEQRSLILQEINESMDAILNQLNGLNITLENSIAVGKEFENVSQIWKLFYNGL 68  Kluyveromyces lactis NRRL Y-1140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap