5U0S


Conserved Protein Domain Family
Med14

?
pfam08638: Med14 
Click on image for an interactive view with Cn3D
Mediator complex subunit MED14
Saccharomyces cerevisiae RGR1 mediator complex subunit affects chromatin structure, transcriptional regulation of diverse genes and sporulation, required for glucose repression, HO repression, RME1 repression and sporulation. This subunit is also found in higher eukaryotes and Med14 is the agreed unified nomenclature for this subunit. Med14 is found in the tail region of Mediator.
Statistics
?
PSSM-Id: 400802
View PSSM: pfam08638
Aligned: 131 rows
Threshold Bit Score: 109.118
Threshold Setting Gi: 145348526
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5U0S_N         15 PLPEIVETFSHHVLQELVSLAEVLPSMS----NVEKKKKILDWLLRSRAFTMRLLVLARW--VHLSPSVHRCIDVVAFLQ 88   fission yeast
CBJ25901       22 laSELCLRQTDRAFHDIRRLANILSRVN----HDSRREDLLDYIRSNRARFLKAYAIISWlsGNHGELVANASNALAEAR 97   Ectocarpus si...
Q03570        106 PLNVLLDFAIQHVYHEITVLAELMQRKTndqgEQERKMSLVHFAHATRSQFLKLVALVKW--IRISKRMDVCYSIDYLLD 183  Caenorhabditi...
ESN95203       21 PLSTLMEFLIQRTYHELSILSELLLGKN----DLERKIEICQFANRTKQTFVRLLALVKW--TNSANKVDKCARIFSFLQ 94   Helobdella ro...
EDW30113       32 SMSMLIDFIIQRTYHELTVLAELLPRKT----DMERKIEIYNYAARTRHLFTRLNALVKW--GNSVSKVDKSSQIMSFLD 105  Drosophila pe...
XP_003244766   24 SLSVLIDFIVQRTYHELTVLAELLPRKP----DMERKIEIYKFSNRTRQLFVRLLALVKW--ANSASKVDKSTQIMGFLD 97   pea aphid
Q16FA0         31 PLGRLIDFIIQRTYHELTVLAELLPRKT----DMERKIEIYNFSASTRQLFIRLLALVKW--ANSASKVDKSAKIMAFLD 104  yellow fever ...
XP_015794906   20 SLSRLVDFTVQRTYHELLILTDLLPQKS----DIERKIEIISFANRTRQLFIRLLALVKW--AGSASKVEKCSTIVAFLN 93   two-spotted s...
EDO35223       12 NLSMLIDFLLQKTYHELTVLSELLPRKP----DIERKIEIVQFASRTRQQFVRLLALVKW--AGGAKGVAKCQAISTFLD 85   starlet sea a...
XP_004347922   37 PLSALVEMLLQKAHGELMKLSELLPQFP----DKQRKMAIIDYVQRTRGMFVRLLVVVKW--ASKAAETKSVWELMRFID 110  Capsaspora ow...
5U0S_N         89 GQKFCFQNLVHVL-QDIRYQLSFARLRNSDLVTALDILSTGTSLRLanaPTSKly---mlSESPL--STKQILQTLHALN 162  fission yeast
CBJ25901       98 SQREQIDACQDQF-FFMHGGLFGARQRLYDVPVAVDVLIGGRYPHL---PKGIeycggdiDPRPIfeLPANREEIVLRVD 173  Ectocarpus si...
Q03570        184 LQSQYFIDTADRLvAMTRGDLELARLPEYHIAPAIDVLVLGTYNRM---PSKIkea--fiPPAKI--TPREQKLVTSRLN 256  Caenorhabditi...
ESN95203       95 QQQLLFVETADCLaRMARETLVHARLPSFSLPCAIDVLMTGTYPRL---PFCIkek--ivPPEPL--PPLEKKRVLTKLT 167  Helobdella ro...
EDW30113      106 KQNMLFVETADMLaRMSRETLVRARLPNFHIPAAVEVLTTGTYNRL---PTCIrer--ivPADAI--TPAEKKQTLLRLN 178  Drosophila pe...
XP_003244766   98 KQSLLFIDTADMLsRVARETVVSARLPNFHIPSAVEVLTTGTFSRL---PACIrer--ivPPDKI--TPAEKRETLLQLN 170  pea aphid
Q16FA0        105 KQSLLFMDTADMLsRMARETLVNARLPNFHIPAAVEILTTGTYSRL---PSIIrer--ivPPDPI--TTLEKRQTLQRLN 177  yellow fever ...
XP_015794906   94 KQAMFFIETADSLaKMARENLVQARLPALQLPAAVEVLTLGSYTRL---PTCIrdr--ivPPDSI--TPAEKKATLQRLN 166  two-spotted s...
EDO35223       86 QQSMVFVDTADMLaRMARETLVQARLPTFCLPAAVDVLTTGTYQRL---PTCIrdk--ivPPDPL--SLSEKNKTLQRLN 158  starlet sea a...
XP_004347922  111 SQTACFTVAADAL-YWTHRNLGHARTPAFALSTAIDVLSTGSYTRM---PKAIsd---ivPPITV--NRKDIRRVYQQLN 181  Capsaspora ow...
5U0S_N        163 MLIRIRLSL-YEIIPTPFQHFTIANGRCTFTVPNEFSVSL 201  fission yeast
CBJ25901      174 RAIRLALLR-RGGVPNQFTSHTVKNGVLTLTVNGEFELMV 212  Ectocarpus siliculosus
Q03570        257 QLIESRLSRlSSGIPPNIKEIHINNGLATLLVPGEFEIKI 296  Caenorhabditis elegans
ESN95203      168 QVIEYRIV--MNDLPHSMCKPVIENGRVKFTVDHEFEVFL 205  Helobdella robusta
EDW30113      179 QVIQHRLV--TGKLLPQMREFRIKNGRVTFEVKHEFSVAL 216  Drosophila persimilis
XP_003244766  171 RVIQHRMV--CSNLINEMSCKKVANGRVTFRVENEFQVSL 208  pea aphid
Q16FA0        178 QVIQHRLV--TGNLLPQLRKFKIENGRVTFKVDHEFEVSL 215  yellow fever mosquito
XP_015794906  167 QIIQQRLV--ISNLSPQMKNFKIDHGRVIFHVNHEFEMAL 204  two-spotted spider mite
EDO35223      159 EVIQHRLV--LARIPPQMASLKIADGCVTFHVDNEFEVSL 196  starlet sea anemone
XP_004347922  182 DVVRILLV--DSFVPDGFSQVLVNDGRVWLEVPYEFKIAL 219  Capsaspora owczarzaki ATCC 30864
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap