Conserved Protein Domain Family
Nup153

?
pfam08604: Nup153 
Nucleoporin Nup153-like
This family contains both the nucleoporin Nup153 from human and Nup154 from fission yeast. These have been demonstrated to be functionally equivalent.
Statistics
?
PSSM-Id: 400773
View PSSM: pfam08604
Aligned: 10 rows
Threshold Bit Score: 256.755
Threshold Setting Gi: 1351657
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023200657  102 PSTSRASLNFQEyVLSRPPLSRSH--LHFTPLDassptmgaSSSLFSPPSTSSAPg---PF--STGFSLVKEIKDNLSQH 174  southern plat...
XP_007487965   86 PSTSRSALNYPD-VLTRPSLHRSH--LNFSMLE--------SPTMHCQPSTSSAF----PIg-SSGFSFVKEIKDSTSQH 149  gray short-ta...
P49790        113 PSTTSTASNYPD-VLTRPSLHRSH--LNFSMLE--------SPALHCQPSTSSAF----PIg-SSGFSLVKEIKDSTSQH 176  human
1_pfamImport    1 PSTSQSAINDTD-ALTRPSLHRAN--LNFNLFD--------SPAMNCQPTTST-F----PIg-TSGFSLVKEIKDSTSQH 63  
XP_007245800  100 PSTSKASLNFQD-VLSRPPLNRSH--LQFPTQDgsps-lgvSNFLFSQPSTSTASfaasPFavASNFSLVKEIKDSSSQH 175  Mexican tetra
NP_001313313   98 PSTSRASLNFQE-ALSRPPLNRTH--LQFPSLDgspa-lggSSSLFSQPSTSTAPfsgsPFavTSNFSLVKEIKDSSSQH 173  zebrafish
Q09904        112 PRKPKQKQDYTN----SPTLFKRHdeLSLKSLNsl----hpSSALSKKLGSTSQHqiatPKssASLLNILRSLHD--EQK 181  Schizosacchar...
XP_010706639   81 PSTSRSALNFSV-VLTRPSLHRSH--LNCTVLD--------SAVPPCQPSTSSTL----GIg-NPGLSLVKEIKDSTSQH 144  turkey
XP_030121369  105 PSTSRSALNFSD-VLTRPSLHRSH--LNCTVLD--------STVPHCQPSTSATL----GIg-SPGLSLVKEIKDSTSQH 168  zebra finch
XP_014350513    1 -----------------------------------------------mgshadgssrkrlrltacgaavgtigglwqqri 33   coelacanth
XP_023200657  175 EDDNISTTSGFSSRASDK-DVPTSKTASLPQLWSPEMDRTNSGPQQSQSSLKKPSFNLSVFGNSSNSTLNSTLLNSSQLG 253  southern plat...
XP_007487965  150 DDDNISTTSGFSSRASDK-DIAVSKNTSGPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLG 228  gray short-ta...
P49790        177 DDDNISTTSGFSSRASDK-DITVSKNTSLPPLWSPEAERSHSLSQHTATSSKKPAFNLSAFGTLSPSLGNSSILKTSQLG 255  human
1_pfamImport   64 DDDNISTTSGFSSRASDKaDMAVSKNVGVPPLWSPEVDRSQSLSHNSSMTSKKPTFNLSAFSSLSPSLGNASFVN-SQLG 142 
XP_007245800  176 EDDNISTTSGFSSRASDK-DVPTSKTA--PLLWSPETDRTHSGSQSGQTGLKKPAFNLSVFGTSSSSVMNNSVLNSSQLG 252  Mexican tetra
NP_001313313  174 EDDNISTTSGFSSRASDK-DVPTSKTV--PLLWSPETERTHSGSQTAHSGLKKPAFNLSVFGTSSSSVLNSSVLNSSQLG 250  zebrafish
Q09904        182 NTLNISSVK--QDRITEA---------------NPTCE------------KRKPSRSPSPMLSKKKSVARASENEPSAKQ 232  Schizosacchar...
XP_010706639  145 DDDNISTTSGFSSRASDK-DIAVSKTNSAPLLWSTEAERSHSLSQHSASSSKKPAFNLSAFGALSPSLGNTSVFKTSQLG 223  turkey
XP_030121369  169 DDDNISTTSGFSSRASDK-DITVSKNTSAPLLWSPEAERSHALSQHPASSSKKPAFNLSAFGSPSPSLGNTSVFKTRQLG 247  zebra finch
XP_014350513   34 ffnegilgrvtdtvksivpgwlqryfrqnddtvlaseedgehtegretlvnnrvcpsnengafadgrgtpepttsdadep 113  coelacanth
XP_023200657  254 DSPFYPGKTTYGG-AAAVRSSRG-RpGTPYQAPVRRQIKAKPAGAQPCGVTSATARR----------ILQSLERMSSPLA 321  southern plat...
XP_007487965  229 DSPFYPGKTTYGG-AAAVRQSKI-R-NTPYQAPIRRQMKAKQVNSQSYGVTSSTARR----------ILQSLEKMSSPLA 295  gray short-ta...
P49790        256 DSPFYPGKTTYGGaAAAVRQSKL-R-NTPYQAPVRRQMKAKQLSAQSYGVTSSTARR----------ILQSLEKMSSPLA 323  human
1_pfamImport  143 DSPFYPGKTTYQG-AAAVRSSRV-R-SNPYQAPLRRQVKAKPANAQQYGVTSSTARR----------ILQSLEKMSSPLA 209 
XP_007245800  253 DSPFYPGKTTYGG-AAAARSGRA-RpGTPYHAPVRRQIKAKPAGAQPCGVTSATARR----------ILQSLERMSSPLA 320  Mexican tetra
NP_001313313  251 DSPFYPGKTTYGG-ASAMRTARS-RpATPYQPPVRRQIKAKPTGAQPCGVTSATARR----------ILQSLERMSSPLA 318  zebrafish
Q09904        233 NKSF-SGNDSHKS-LTDIRDKENgE----------TEVSAKN------HVPHRSSRRrrrhqrlipiIYETLEQM--DLR 292  Schizosacchar...
XP_010706639  224 DSPFYPGKTTYGGaAAAARQTKV-R-IAPYQTPVRRQMKAKQANVQSYGVTSSTARR----------ILQSLEKMSSPLA 291  turkey
XP_030121369  248 DSPFYPGKTSYGGaAAAARQTKV-Q-ISAYQPPIKRQVKAKQANVQSYGVTSSTARR----------ILQTLEKMSSPLA 315  zebra finch
XP_014350513  114 stgrselnfsdvsmrpaiyrshihfsvfdsptlpcqpststaypigssgfslvkeikdstsqheddnisttsgfssrasd 193  coelacanth
XP_023200657  322 DAKRIPAAtaGSPSRSPSMDILNQDGPRHQAKKKRM-DSNLPPVQKLVVPAAASVSGNRSVSFRPTLTPGG----LTRAL 396  southern plat...
XP_007487965  296 DAKRIPAA--ISSPLSSPLDRSGIEIIDIPAKRKKM-ESHYPPVQRLMTPKPISIATSRSVYFKPSLTPSAegikTSQRI 372  gray short-ta...
P49790        324 DAKRIPSI--VSSPLNSPLDRSGIDITDFQAKREKV-DSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGefrkTNQRI 400  human
1_pfamImport  210 DAKRIPSN-----SLSHTPEKSLMDIAENPSKRKKV-ESPFPPVQKLVTPKSISVSTNRSLYIKPSLTPSAvsntSSRRV 283 
XP_007245800  321 DAKRIPST--VSSPLSTSLNHSDLDVSSFQSKKKKV-EPALPPVQKLVIPAAASVASNRSMSFRPSLTPGS----VSRVV 393  Mexican tetra
NP_001313313  319 DAKRIPST--VSSPLSASLNHTDLDISNYQAKRKRL-EPSVPPVQKLVVPAAAAVSGNRSISFRPSLTPGG----VSRGV 391  zebrafish
Q09904        293 KPVLVNAEvqTDSNPGNTMFIDKQDI-----------------YHRLSTPTSRK---------RQTLEKGHi--kAFSAV 344  Schizosacchar...
XP_010706639  292 DAKRIPSS--VTSPLSSPVDRSMLDITGFHSTRKQM-ESHHPPVQKLVTPKAISLSGSRTQYFKPSLTPSAdsskIHQRV 368  turkey
XP_030121369  316 DAKRIPSS--VSSPLSSPVDRSVLNVTNFQSRQNQV-DLQHPPVQKLVTPKPISLTGSRITYFKPSLKSATnsrkIHQRV 392  zebra finch
XP_014350513  194 kvctvihlpcadiiyllqmadrtafeildfqakRKRhDSQYPPVQKLLTPKAVSIATNRSFYIKPSLTPTGqtnkTTERT 273  coelacanth
XP_023200657  397 DRTPREKTPTRQSPQlpeatpGP----SQSTRSFSdpvYPLSSTP-AASSLS----SG------GGKIRRERtTARPSSK 461  southern plat...
XP_007487965  373 DKKHNIGCEKNLSPG------QK----EQHESDFS---YPNFSTP-ATNGLP----SGvg---gGGKMRRER-TRFVPKL 430  gray short-ta...
P49790        401 DNKCSTGYEKNMTPGq-----NR----EQRESGFS---YPNFSLP-AANGLS----SGvg--ggGGKMRRER-TRFVASK 460  human
1_pfamImport  284 QPDKHNCTLSERQIRs-----VE----KQGESSFS---YPKFSTP-TSNELL----SRg-----GGKMMRQK-GSHYSTK 340 
XP_007245800  394 DKSNKE-TPVRRSPKrpd-apAP----PPSTSGLS---YPLSSTP-TTSNTG----AG------GGKMKRER-SIRPSSK 452  Mexican tetra
NP_001313313  392 EKTSRE-TPVRQSPPisepaqAP----PPSTSTLS---YPLSSTP-AANSAA----LG------GGKMKRER-AIRPSSK 451  zebrafish
Q09904        345 DEDLDEIFACEDDVHytalpkQN----PKSERILE----PIIASP-KDNTSD----KG---------------------- 389  Schizosacchar...
XP_010706639  369 DTKHKEVKEKSLPEEq-----RV----EPSESNLT---YPKFSTP-ASNGLT----SGvs--ggGGKMRRER-GVHYVSK 428  turkey
XP_030121369  393 DTDHQ----DMMEESf-----PAekpvKSSESNLS---YPKLDTP-ASNGLS----SGgrmesaCGKMRRER-ERYSASR 454  zebra finch
XP_014350513  274 ESRHRE---------------IR----EKTSEVNNapvEPPKSSGtNSYSYPtfstPAangllpGGGK-MKReRGAHFTA 333  coelacanth
XP_023200657  462 HTEEDEvAEAPVLPSISLPINKSSLPTFSFSPSlp---pAISVSSSPSFTSTTPAKEtLANKDPPKASTPPCApfTFSSP 538  southern plat...
XP_007487965  431 PDEEEE-VEAPVLPKISLPITSTSLPVFSFCSP------LSTSSSLSPINATQTLSN-KIQAASPNKTGSPVF--RFSSP 500  gray short-ta...
P49790        461 PLEEEE-MEVPVLPKISLPITSSSLPTFNFSSP------EITTSSPSPINSSQALTN-KVQMTSPSSTGSPMF--KFSSP 530  human
1_pfamImport  341 PAEEPReLDLPVLPEIPLPLSTAALPSFKFLKS------QFTHRSLSVVRVQCPRHT----GQRETPNQSTMFthTYRPP 410 
XP_007245800  453 KT-DDEvSEAPDLPAISLPLSNSPLPTFSFSSPp----pTSTLKPNNKPSTLIPKEP-AISKQAPTVPTTPDApfTFSTP 526  Mexican tetra
NP_001313313  452 RP-DDEvAEEPDLPPASLP-SNFTLPTFTFSTPp----pTSSLKSSTAPLITVSEEP-AANKQPAAPSTPPSApfTFSSP 524  zebrafish
Q09904        390 -------------------LLTKSAPTFEELQAsitpkpVKTSPNDTALTLANAEDNkTFEHQPLSKDTEAPKsqFSSSP 450  Schizosacchar...
XP_010706639  429 SGQEQE-VEEPVLPKISLPISTASLAPFNFSFL------TSSTVSSSPSTVSTSVMNk---VQPTSNVGSPVF--RFSSP 496  turkey
XP_030121369  455 PAQKQQlMEQEVLPEVPLPISTASLPTFSFSFP------TSSAVSSSPSIVSKAVMN-KVQPAS--NVGSPTF--VFSSP 523  zebra finch
XP_014350513  334 KQSQEEqVEVLDLPRISLPISTASLPTFNF---------SPSTTASTPASVTKSAVS-KAQLSNSSTASSPAF--TFSSP 401  coelacanth
XP_023200657  539 IVKAT----AASPPSYSPaVGFT-FSAPVAKLAP-SMSNGNLTAPTa-------tAVKPI----ASKSTEEFVGPFKPAK 601  southern plat...
XP_007487965  501 IVKST----EADILPPTS-IGFT-FSVPVVKSSEiSVCSNISGSTIssvk--datTLNSTs--nNKEDGEDYEGPFRPAK 570  gray short-ta...
P49790        531 IVKST----EANVLPPSS-IGFT-FSVPVAKTAElSGSSST-LEPIisssahhvtTVNSTn--cKKTPPEDCEGPFRPAE 601  human
1_pfamImport  411 VGQHSisilKTEe------VDFT-FSVPTVKVSS-ATTSIDSKVSAvsttakthiAVNNS----SAKDSDEQVGFCKPAK 478 
XP_007245800  527 IVKAT----AASPPSFSPsTGFT-FSAPTMKTTP-SASNGKPAPAAv--------aVKPA----ARECKEEFEGPFKPAK 588  Mexican tetra
NP_001313313  525 IVKAT----AASPPSFSPsSGFT-FSAPTMKMGP-SFSNGKIVPSVa--------pVKSV-----VIEEKEFEGPFKPAK 585  zebrafish
Q09904        451 TKESTtrksEVEPPSPSKeIKSShFSVPEFKFEPkTEATTD-----------------------KKLNVPKFE--FKPTA 505  Schizosacchar...
XP_010706639  497 IVKST----EAEVLPPLS-IGFT-FSVPVVKSAErSGCSDTAVTSLltr---dttTVNSIs--nKKEEKEEYDGPFKPAK 565  turkey
XP_030121369  524 IVKST----EVEVLPPLSqIKFT-FSVPVVKSSElSGSTDTPVTSIlsp---gsaTVNSTs--nKKEEEEEYDGFCKPAK 593  zebra finch
XP_014350513  402 IVKST----EADLPPFAPsMGFT-FSIPVAKTASlAASTGVSAVPVfsterdttsPLPSTatpvSKNREEDFEGPFKPAK 476  coelacanth
XP_023200657  602 T-------LKQGSVLDLLKSPGFASPV 621  southern platyfish
XP_007487965  571 T-------LKEGSVLDILKSPGFTSPK 590  gray short-tailed opossum
P49790        602 I-------LKEGSVLDILKSPGFASPK 621  human
1_pfamImport  479 T-------LKEGSVLDILRSPGFSSSP 498 
XP_007245800  589 V-------LKQGSVLDILKGPGFASPA 608  Mexican tetra
NP_001313313  586 V-------LKQGSVLDILKGPGFASPS 605  zebrafish
Q09904        506 TadvqtnrLKENE----PKPTFFAQLP 528  Schizosaccharomyces pombe 972h-
XP_010706639  566 V-------LKEGSVLDILRNPGFTSVK 585  turkey
XP_030121369  594 F-------LKQGSVLDILKSPGFMSGK 613  zebra finch
XP_014350513  477 A-------LKQGSVLDILKEPDFVSPP 496  coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap