Conserved Protein Domain Family
Nbs1_C

?
pfam08599: Nbs1_C 
DNA damage repair protein Nbs1
This C terminal region of the DNA damage repair protein Nbs1 has been identified to be necessary for the binding of Mre11 and Tel1.
Statistics
?
PSSM-Id: 400771
View PSSM: pfam08599
Aligned: 18 rows
Threshold Bit Score: 82.3371
Threshold Setting Gi: 405968443
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDV25459      442 KNFKKFRKSYYPGRDrvGLPTIIGGNDLLRYTAGSDSSLGDWIHEARRAHDEKAQEDQLADDLF 505  Trichoplax adhaerens
XP_008106619  545 NNFKRFKKVAYPGAG--QLPHIIGGSDLIAAHSRKDSEMEEWLKQEMEEQTRHEREESLADDLF 606  green anole
XP_016151603  712 KNFKMFKKVAYPGAG--QLPCIIGGSDLIAYNAKKNSELEDWLRQELEEQDRRTREESLADDLF 773  Collared flycatcher
Q9DE07        682 NNFKTFRKVPYPGAG--QLPYIIGGSDLVAHQARKNSELEEWLREELEEQNRRAREESLADDLF 743  chicken
Q5RCV3        683 KNFKKFKKVTYPGAG--KLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLF 744  Sumatran orangutan
XP_017950647  612 QNFKKFKKVAYPGAG--SFPHIIGGSDLIAHDRKRNAELEQWLRQEVEEQTQQAKEESLAEDLF 673  tropical clawed frog
XP_006008581  700 KNYKRFKKVAYPGAE--GLPHIIGGSDLIAHQSKKNSELEEWLQQEMQEQSQRAREEFLSDDLF 761  coelacanth
XP_015213307  717 KNFKKFRKVAFPGTA--GLPKIIGGSDLVPHQT-KNSELEEWFRQEVVAKSQYEKEDSIADDIF 777  spotted gar
EDO41630      720 RNFKKFKKQWYPGRDs-VLPRLIGGSDLAVFESQTGVEQELWFAEAREVDAEQERLDRQAEQMF 782  starlet sea anemone
EKC33515      770 KNFKKFKKNQNLGSN--GLPRIIGGSDLQPHVPSQRKEVEDWFKEALEAESQQSEAERRAQELF 831  Pacific oyster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap