Conserved Protein Domain Family
Sds3

?
pfam08598: Sds3 
Sds3-like
Repression of gene transcription is mediated by histone deacetylases containing repressor-co-repressor complexes, which are recruited to promoters of target genes via interactions with sequence-specific transcription factors. The co-repressor complex contains a core of at least seven proteins. This family represents the conserved region found in Sds3, Dep1 and BRMS1-homolog p40 proteins.
Statistics
?
PSSM-Id: 400770
View PSSM: pfam08598
Aligned: 60 rows
Threshold Bit Score: 93.9494
Threshold Setting Gi: 1005954788
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004179054            33 LEIKVSKIYNNFINNKDVYYQERLTFLQTQLTTLHQGNNKEYLRKFKDLEEERDLELIRLRLFEEYRINRSRIEFQQDIK 112  Tetr...
XP_004197397           302 AVEELISIETAFASLRDKLYKDKLELLEHELQLCLDGSHPELSKVYHKVNQFHRESMKQANANLTYRLRCIDIETVATRT 381  Pich...
XP_002490626           314 ALSSLNELEVDFAKLKDMIYGNQMTKLQYELELCLKGSHPEFVNIVDKINRNFDAKLNRLIMTQKYQLQCIDNQTKATRL 393  Koma...
ESW99844               110 ALEEIKNIEIEFALLKDKLYETQMNKLLFELELCNSNKHPDFLNYSNMIENNFQAKVARYVNLQKYKLKCLDNQTRATRV 189  Ogat...
WGS:AAWC:PGTG_16224.3  673 ALEAMVKIEIMFAQVRDRLYAERLSDVYRETAAVQHGSHPELNEYYQLLERKRDARLSLAHKIFNLKEIELNKKREAATN 752  Pucc...
XP_007855938           447 ALEVLASIELRFALVREKLYVEKMQSLAWEESLVEDGTHPELIYLQSELSRRKDKRLELAARKRTYEFSHVSRKRKLEED 526  Moni...
CCF49854               461 AMEALTKIEIGFAMLRDRLYVERLQEISKEGQMILDGTHPELLHLTKAIEMRRQRRTQLVEMRFEQQEQQYQRVAKAEEF 540  Usti...
CBQ70159               439 AMEALTKIEIGFAMLRDRLYVERLQEISKEGEMILDGTHPELLHLTKAIETRRQRRTELVEFWFEHQEKQYERVAKAEEF 518  Spor...
1_pfamImport             1 CLDEMTTIEKQFMDIRDQLYRERHTQIMQKLDEVNAGTAPEYLQQLLALETSKQVRMQVSDIYQRLRLNALKTNLEAETQ 80  
XP_015785800            52 HINEMLDLERQFLALKEQLYMERIKQIEKKLEEVKAGNAQEYLGPVDDLHHQMEIRMKVAGILKEFKFKNVNIQYEAEKQ 131  two-...
XP_004179054           113 KAKDEHEKLIKLCKEKLYENIDYKIKKLQEERILLDFANAHSYamdystlsfnnsnnyngskn-sngkfnsnnnmynnei 191  Tetr...
XP_004197397           382 SIHQNFLKKLMDTRNDMISDVTYMWYKINKERNQMDQvvpdf-------------------------------------n 424  Pich...
XP_002490626           394 QLHQQYMKDAQDLKLRSISKTTSKWYEINKERRHLDNVILgvpdy----------------------------------- 438  Koma...
ESW99844               190 AIHQQFIKCCQDLKNEEITNITSNWYEINKERRALDNVTLnlpdy----------------------------------- 234  Ogat...
WGS:AAWC:PGTG_16224.3  753 SVWTRWYEAKTELHDSMIVETQKQMKQLEREKCQPDLRYNVEVqllprpiiprhnpgrrsrkrarlemdetneellaiql 832  Pucc...
XP_007855938           527 ATWSWWKLAKDELQTDMIAETNRKKRRLERDRRQMER------------------------------------------- 563  Moni...
CCF49854               541 AAWSIWRSSCASLRRDMMDEFSRKRRRLDREKRTLDA------------------------------------------- 577  Usti...
CBQ70159               519 AAWSIWRSSCASLRRDMMDEFSRKRRRLDREKRTLDA------------------------------------------- 555  Spor...
1_pfamImport            81 ANAQHLKNEKQILMGRIEFDLSEKMHRLEEDRENVDLSN----------------------------------------- 119 
XP_015785800           132 AVDQNFQSEKNLARDQIRRELEERIRRLEEDRNSVDLWGDSLY------------------------------------- 174  two-...
XP_004179054           192 dngfKNTRSHTS---------STwetssnneylagaainnannnlangnlsngrasreSGNESyNTTd------TGFDNR 256  Tetr...
XP_004197397           425 fsaiPKIPNYTIpaqseedpaASsysssl------------------------tkkiaKQNTl----------vELVQHR 470  Pich...
XP_002490626           439 yqfnPDLASAAKknqt------------------------------------------------------alvqELANQR 464  Koma...
ESW99844               235 yqynGDITAANVnsqs-------------------------------------------------------ainRLVVQR 259  Ogat...
WGS:AAWC:PGTG_16224.3  833 htaiAKRATVNLstltseeswAD-----------------------------------LSVMKpQSRnahldpvNILCAP 877  Pucc...
XP_007855938           564 --------------------------------------------------------------PvPIRhipgmpmEILTAP 581  Moni...
CCF49854               578 --------------------------------------------------------------PrPARkhqifetELVRNP 595  Usti...
CBQ70159               556 --------------------------------------------------------------PrPARrhqifetELVRTP 573  Spor...
1_pfamImport           120 --------------------------------------------------------------------------QLWGDG 125 
XP_015785800           175 ----------------------------------------------------------NPKKKrRIGnngstyyEVGPSR 196  two-...
XP_004179054           257 RSLRrrrvgantggqtsnieesnygyssatgagskkrktgksnnnsqdtnhttNDAELfQSLAD---------------- 320  Tetr...
XP_004197397           471 NNVN-------------------------------------------------------QQLGI---------------- 479  Pich...
XP_002490626           465 RNFQ-------------------------------------------------------QELGV---------------- 473  Koma...
ESW99844               260 NALY-------------------------------------------------------HELSS---------------- 268  Ogat...
WGS:AAWC:PGTG_16224.3  878 QSMA-------------------------------------------------------TYFRDdpyepttepskkllps 902  Pucc...
XP_007855938           582 PTLR--------------------------------------------------------QLIDnppfgsrefqqprlkn 605  Moni...
CCF49854               596 DRLH-------------------------------------------------IPLQSsAQIMDdaengrp--------- 617  Usti...
CBQ70159               574 DRLH-------------------------------------------------IPLEPpSQAGDadraqangs------- 597  Spor...
1_pfamImport           126 RDLDpif------------------------------------------------------------------------- 132 
XP_015785800           197 DQLHlld------------------------------------------------------------------------- 203  two-...
XP_004179054           321 ---------------------RPDLQRLl------FGIEYV----------------NAnkDKkkGRNsQRYS------- 350  Tetr...
XP_004197397           480 ---------------------LNGLVQ--------FHGFPCa-------------------------------------i 493  Pich...
XP_002490626           474 ---------------------LTALQQ--------NYRFPSsl------------------------------------- 487  Koma...
ESW99844               269 ---------------------LKGIEKY-------TGGFPSsl------------------------------------- 283  Ogat...
WGS:AAWC:PGTG_16224.3  903 lgsgdkldnhhnlardpaiigAEKLIALnpklihsRASYPSqvqslsspssklhsrrLNngLDglTNIhTSSS------- 975  Pucc...
XP_007855938           606 khrnrevhtnvnassgkrdmgTNSAGALv------PLAYPE--------------------------------------- 640  Moni...
CCF49854               618 --------------grkgaakRKAMASReidagdqFVAYPD--------------------------------------- 644  Usti...
CBQ70159               598 ------------kagrkqsakRKALAREida-adeYVAYPD--------------------------------------- 625  Spor...
1_pfamImport           133 -----------------------------------------------------------rkKKkkEEVyPSFSfggvkrk 153 
XP_015785800           204 ------------------------------------------------------------------------------rr 205  two-...
XP_004179054           351 NKSAPT----------LKSLNTEEVVDDI 369  Tetrapisispora blattae CBS 6284
XP_004197397           494 ASGLNDddqipssellLKSATNEEILEDL 522  Pichia farinosa CBS 7064
XP_002490626           488 --------------nhLTAAREDEIESDL 502  Komagataella phaffii GS115
ESW99844               284 --------------ndLKSCTGEEVQQDL 298  Ogataea parapolymorpha DL-1
WGS:AAWC:PGTG_16224.3  976 SRTVRN----------SNRLTSEQIEPDl 994  Puccinia graminis f. sp. tritici CRL 75-36-700-3
XP_007855938           641 ----------------LPTLSSADVGNDL 653  Moniliophthora roreri MCA 2997
CCF49854               645 ----------------LKGLAEADVMTDI 657  Ustilago hordei
CBQ70159               626 ----------------LKGLAEADVMMDI 638  Sporisorium reilianum SRZ2
1_pfamImport           154 KKPVTVtgp-----yiVYMLRDCDIMEDW 177 
XP_015785800           206 RKPVPVsgp-----yiVYMLKDSEIIDDW 229  two-spotted spider mite
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap