3VP8


Conserved Protein Domain Family
Tup_N

?
pfam08581: Tup_N 
Tup N-terminal
The N-terminal domain of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor.
Statistics
?
PSSM-Id: 400755
View PSSM: pfam08581
Aligned: 52 rows
Threshold Bit Score: 96.8139
Threshold Setting Gi: 528318081
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VP8_A    11 KLNELLDAIRQEFLQVSQEANT-YRLQnQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIKHLKLGLEQRD 88 
CEL01581  15 RLNELLDQLRQEFENQSR--------S-TGEFEHQLTGQLQEMEMIRQKVYQLEQAQIKMKQDYEAEIRMLRHELESRG 84  Aspergillus calidoustus
EFI93780  30 RLDEHLDLIRQDYEIMATELTD-ARAQ-KEELETKVVAQINEIALITNTLHELNSKHARLRQTYEQEVTALRAQLHEAQ 106 Schizophyllum commun...
EFC49135  63 RVVDWMEQIKKDYLTLEQEYLN-IKHL-KEELERKLESQLGDFQVMHNAIFDLENAFTASKQHYEERIQQLNATIHELK 139 Naegleria gruberi
EPS93362  30 KLNECFETIRQEFDAVAHELVH-LRGQ-RDDLDNKVNGQVNELNIIRQSLYDLETQHGKIRQQYEQEIAALRAEVlalr 106 Fomitopsis pinicola ...
EMD35275  33 RIGEAFEIVRQEFDVLAGEINN-LRGQ-RDDYENKVTGQVNELNIIRQSLYDLETQHSKIRQQFEDEVRALRAEVHALr 109 Gelatoporia subvermi...
EKM75145  30 RLNEAFDSIRAEFDSALTEANV-VRNQ-KDEIEGKVVQQVNELNIIRQSLYDLEAQHNKVRQQFEDELGRLRSELLttr 106 Agaricus bisporus va...
EGO03645  26 RLTESFDAIKQEFDVLSSDLNL-LRNQ-RDEYESKVTSQVNELNIIRQSLYELESQHGKIRQQYEDELTRLRTELHAar 102 Serpula lacrymans va...
EKD02774  35 RVKECFEIIQNEFEAVAKDNNShWQVQ-REEYEL----QSDELGLIRKTLYDLEAAHGKIRAEYEAEIARLRRELEARG 108 Trichosporon asahii ...
Q5KGF2    31 RLNELFDLIRQEYETLGTDGNI-WKQQ-RDEYEAKVQSQINELGMIRQSLYELEANHAKIRQEYETEIARLRRELESRG 107 Cryptococcus neoformans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap