3ZHP


Conserved Protein Domain Family
Mo25

?
pfam08569: Mo25 
Mo25-like
Mo25-like proteins are involved in both polarised growth and cytokinesis. In fission yeast Mo25 is localized alternately to the spindle pole body and to the site cell division in a cell cycle dependent manner.
Statistics
?
PSSM-Id: 400746
View PSSM: pfam08569
Aligned: 120 rows
Threshold Bit Score: 169.989
Threshold Setting Gi: 122045830
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ZHP_A        10 FSKS--------HKNPAEIVKILKDNLAILEk----QdkkTDKA-SEE----VSKSLQAMKEILCGTN-EKEPP-TE--- 67 
XP_001708185   1 --------mnrkRSSVSDLVVAIAKMLSGRTe---qAsfkEAD--AEA----LKVSISQLKSQVTS------PN-PQlqr 56  Giardia lamblia...
Q5CWP8       146 IFLD--------------LVDKQEKELNLWL-----NdrnQQKmeWNErverIYKQIFTLSEIFCD-------------- 192 Cryptosporidium...
XP_001314990   3 WFTK---------AQAKGFPKRLRMALESME-----LhqnNDT--IND----VKLYVSKITDTLNVD--SYN---RE--- 54  Trichomonas vag...
EAY20933       4 WVTK---------AKRKGLAKKLRICLESIR-----VsqtAQK--YKQ----LTPILDQINETFIQP--EFQ---QD--- 55  Trichomonas vag...
XP_001314839  22 WFGQ---------MKPARIVQKAIDGLKNYMq----EnntKEK--KAEflaiIDKNFGRMTDILYKRK-EGDEA-SS--- 81  Trichomonas vag...
A8X6J7         7 rtqianpminavGETAEQAVKKLEKVFEVLKd-------rNERfpLTE----ISKQIDVIWESVFSVThATAPQ-KK--- 71  Caenorhabditis ...
Q4E0T3         9 RSSKgflqflrsTEDPMIVDANLLLLLQDLS-----------------------------------------SPtEDais 47  Trypanosoma cruzi
EFJ32642       5 FFKPf------rPKSAAELVKSTRDALAALDdktvaDvrlLDKA-LEE----VDKNLLAMKHMILGDG-EAEPS-PD--- 68  Selaginella moe...
EDQ55343       5 FFKQl------kPKTPAELVRQVKDSLSSLDtktmgDtrlLEKS-LEE----VDKSIKVMKDLLLGDT-DTEPN-AE--- 68  Physcomitrella ...
3ZHP_A        68 AV-AQLAQELYSS-GLLVTLIADLQLIDFEGKKDVTQIFNNILRR-----------QIGTRSP----------------- 117
XP_001708185  57 AHyNEFTRVIMTD-NTLVDIVGGLAWLDFDSRKSLISLVAGLAHR------------ASSGDPadda------------- 110 Giardia lamblia...
Q5CWP8       193 --------------SLLLNITCVLGYVSMEEHSLWVSIISLLIVFeirscqhtvllK-ENELIneidq------------ 245 Cryptosporidium...
XP_001314990  55 NLpHIINKKLYRD-KTVANILKFMPYFDQTMNNSVSTLLQSSIRE-----------DPTDSLP----------------- 105 Trichomonas vag...
EAY20933      56 DLpHILNGKIYRD-HTVAMLIGLLPFFDQPTINAISTLFQTTIRE-----------FPDESLP----------------- 106 Trichomonas vag...
XP_001314839  82 RA-LQLVTEISHT-DFVMLGLDAMPFLPVEQRKQFTIIFTGAISH-----------QTGSEFP----------------- 131 Trichomonas vag...
A8X6J7        72 ---YELAEEFLNHpGVVKNLLMVFDGVQVETKRKIRDLLIFIRTW------------TSNDFLadaegslvpnprq---- 132 Caenorhabditis ...
Q4E0T3        48 LSsAGLF-------HLLQVLVERTNDDWLEVRKKIAFVFSDLISK-----------GHGDVLAdaliygrlekttsgear 109 Trypanosoma cruzi
EFJ32642      69 LV-VQLVAEVCKD-DFLEILIHKLPNLGWEARKDTVQVWCILLRQ-----------K-GGL------------------- 115 Selaginella moe...
EDQ55343      69 VV-AEVIQEACKI-DVLELIVQKIPTLDWEARKDCVHIWCAVLRI-----------KVGAVQY----------------- 118 Physcomitrella ...
3ZHP_A       118 ------------------TVEYI-SAHPHILFMLLKGYE-AP-QIALRCGIMLRECIR-HE------------------- 156
XP_001708185 111 --------------dpalLVNYI-LSHQDLLDVLLDGYK-LP--QPFHVTTILCEYIKvYS------------------- 153 Giardia lamblia...
Q5CWP8       246 --------------enfvILEWLnKNCDEFFSLLLKQYSiIP--ITYKIGEVLRDISTiLNlaqgpgivdkqnnktfpis 309 Cryptosporidium...
XP_001314990 106 --------------------KYL-INHKEALDTLLSYLS-IP-KLSSIANILIRECIR-NE------------------- 142 Trichomonas vag...
EAY20933     107 --------------------KYL-IEHTETLDQLLSYFN-QP-NISNSAHIILRSCAI-VT------------------- 143 Trichomonas vag...
XP_001314839 132 ------------------LAIYV-QRYPETLDILLKFYD-TP-ELAASTGEMLRLCAH-HE------------------- 170 Trichomonas vag...
A8X6J7       133 ------arpsqkfqdvlyECRFI------MLHIVHEGYAgS--DSIGLYNDIIRIFAE-DD------------------- 178 Caenorhabditis ...
Q4E0T3       110 ashidlrdsceensdpaaALRQL----KYFIGKLAFAHG--TvERCVPAADVFRTFMR-VP------------------- 163 Trypanosoma cruzi
EFJ32642     116 ------------------AVHCL-ENHPELLDFLISCYQ-NK-DTALNCGVMLRECSR-FA------------------- 154 Selaginella moe...
EDQ55343     119 ------------------GLEYL-ESHTELLDYLVLCYE-NK-EVALNCGTMLRECAR-YP------------------- 157 Physcomitrella ...
3ZHP_A       157 --------PLAKIIL-FSN-----------------------Q-FRDFFKYVELSTFDIASDAFATFKDLLTRHKVLVA- 202
XP_001708185 154 --------IAETILLfCAK-----------------------EqFQRIFSAMSSPNFDVSSDASVVLKDLLTKHEQLTA- 201 Giardia lamblia...
Q5CWP8       310 esfknksnEIAEHLI-YKQ-----------------------EiFTNLIKLSGNQCFDISSDSISTLRCYLFVSPKITN- 364 Cryptosporidium...
XP_001314990 143 --------SFVSYLFeYQY-------------------------VSSFIIYLLGDNFEMVTNAFKTYEEMLNSQISVSS- 188 Trichomonas vag...
EAY20933     144 --------DFTRFLFqNGC-------------------------VGSFVQYLSSDNFDHLSTAFATYECLLMIHPDVTA- 189 Trichomonas vag...
XP_001314839 171 --------TLAKQLLqPAR-------------------------LDLLFTYFTVPHFDVSADSFATFRELIL--CSPNAe 215 Trichomonas vag...
A8X6J7       179 --------ACLMFML-KDKgtdsnevk-------qkfegcvwAiFDRLFNTHTYRGFHILAEIFETFEIIFSQNHEASQ- 241 Caenorhabditis ...
Q4E0T3       164 --------SFLEIILsPAElssdtteertsphpqpkqygfhescigilcrSVASYTTVLCTETWRSLTTALYTNKGLSA- 234 Trypanosoma cruzi
EFJ32642     155 --------SLAAYML-ESA-----------------------S-FELFFKLVELPNFDIASDAFTTFKELLTRHGSVVN- 200 Selaginella moe...
EDQ55343     158 --------TLAKYML-ESV-----------------------S-FEMFFKFVETPNFDVASDAFATFKELLTRHNSVVV- 203 Physcomitrella ...
3ZHP_A       203 DFLEQNYDTIFE--DYEKL-LQSENYVTKRQSLKLLGELILDRHNFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHV 279
XP_001708185 202 TFLDQNPQ-FFT--WFCTL-LHSSNYATRRFSLNLLSTLLLNRANFNAMSRFVESDENLKLIMRLLKDDSAVIRFEAFHV 277 Giardia lamblia...
Q5CWP8       365 EYILKNQQDFFS--NIFKIlIQSTEYVPQRHGLRLLNQLLSLKELSKVMTAFSSNCEYLKIFMNLITSHLNTTSFEAFHI 442 Cryptosporidium...
XP_001314990 189 AYILSHYDIFSL--HFKQL-LRSNVYIVSLLSIPLILNFITREECRPILMYFVNDPYNLECICRHLESRSKKVRSNAYSI 265 Trichomonas vag...
EAY20933     190 EYFSVKWQIFAI--QIKQL-MSSPNYLVQLTFLPILFRFITNESCKSIFFRFLDDSENLQLIMCILKRNSKKIQMHAYSI 266 Trichomonas vag...
XP_001314839 216 DYIKDNAQQITDriHGT---LDEKNYAACRQSLKLIGEIIMTYPSYQQF--YLRNEKNLMTMMKLMSSQYKNLSMEAFHI 290 Trichomonas vag...
A8X6J7       242 YFFYNNLSRFSQ--SFHWL-IAANNFFIQTKSLRFVRDIFSNRYMAEVRRQWMADPSLIKYVFLHLQSIHKTVCLEAVGL 318 Caenorhabditis ...
Q4E0T3       235 SLLLYYFNEFVA--MLVGC-LLGRNFVAKLHALELLASVVEDPVFLRARRKFAESPALLCALLPLTNSSSAHIRFLTFET 311 Trypanosoma cruzi
EFJ32642     201 NYLNSHYDQFFE--LYERL-LSSSNYVTKRQSLKLLGDFLLDRSNTQVMLRYISDKRNLLIVMTLLKDPSKSIQSSAFHI 277 Selaginella moe...
EDQ55343     204 AYLTSRYASFFA--NFDKL-LRSTNYVTRRQSLKLLSDILLERSNSAIMMLYISDVRNLRVMMTLISDPSKNIQASAFHV 280 Physcomitrella ...
3ZHP_A       280 FKVFVASPHKTQPIVEILLKNQPKLIEFLSSF-QKER-TD---DEQFADEKNYLIKQIRDLK 336
XP_001708185 278 FKVFVANPKKTEPVHKILKRNKDKLIEHLLSF-TTET--N---SSDFEEEKGFIVDSISEL- 332 Giardia lamblia ATCC 50803
Q5CWP8       443 FKLFVANPNKSPGIQKILFKNKDKIVEFLIHF-QTSR--T---DPQFISDKQVshllhtsii 498 Cryptosporidium parvum
XP_001314990 266 FKLFVINPHRTQLIRTELHENKTKLIRLIQKV-QLPD------DEELLNERRSVISnl---- 316 Trichomonas vaginalis G3
EAY20933     267 FKLFILNPRKAPPIVNLIKNNRSQLIKYLKDF-NFDE--N---DVELENEKQTLISTIANM- 321 Trichomonas vaginalis G3
XP_001314839 291 FKLFVAIDDKPEPILKILRANSEKLKVFIKGL--LDG-IE---DAELQREKDYLLMELAYLK 346 Trichomonas vaginalis G3
A8X6J7       319 LNIFVQNPCNAPPIHKLISINRKLLLEYCRQNaPNPKdENqalDELFDETITYLVnwneeep 380 Caenorhabditis briggsae
Q4E0T3       312 LKVFIAKGNKPAPIRHILCINRDMLARYVEDY-STKEiAI---NKRLEVEKQKLLQSLTSLE 369 Trypanosoma cruzi
EFJ32642     278 FKVFVANPKKPAPIVHVLAKNRDRLLRFLDNF-HLDK--E---DEQFEEEKELLVKEIEALA 333 Selaginella moellendorffii
EDQ55343     281 FKVFVANPQKPPQIINILAKNRERLLRFLDNF-HIDK--E---DEQFDEEKELLVKEIEGLP 336 Physcomitrella patens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap