Conserved Protein Domain Family
Pam17

?
pfam08566: Pam17 
Mitochondrial import protein Pam17
The presequence translocase-associated motor (PAM) drives the completion of preprotein translocation into the mitochondrial matrix. The Pam17 subunit is required for formation of a stable complex between cochaperones Pam16 and Pam18 and promotes the association of Pam16-Pam18 with the presequence translocase. Mitochondria lacking Pam17 are selectively impaired in the import of matrix proteins.
Statistics
?
PSSM-Id: 400743
View PSSM: pfam08566
Aligned: 70 rows
Threshold Bit Score: 157.705
Threshold Setting Gi: 765554452
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKC99622             27 STSASTSTATDEVppn-ytsPRDLPMTWSDYLAMRKRRRQWSSITSIPTSLGGLIGGA--------MYFAS-KDVDPTQL 96  Trichosp...
EGN95765             33 STTNVTE-------------AAKQKLTWPEYLEIRRNKRKWETAITIPCSIIGFVGGV--------AYFGS-FEADASKP 90  Serpula ...
EMD38237             57 gTTARAKQETVTK-------LEQETLPWAEYLAIRKAKRRWETVMTIPFTIGGLMGGI--------AFFGS-LEVDPTKP 120 Gelatopo...
P0CP48               42 PTSFHTQPSHSTP-------TGPLPLTWPSYLSLRRQRRLWSTLTSVPTTFLGLFLGG--------GYFAS-LEADPSQL 105 Cryptoco...
EDO40484             51 STSDSESTSRDAGakkagesPKQFTLGFEEFQKLKRKVRARQRVAGLPVAAVALMTSSavsaylnpNMFDA--PPDQIQP 128 starlet ...
XP_003386933         42 SSDSSESQ------------PGERMMNFEEYRKLKRSLKWNARVAGIPMGCIAVGISSlanlhfmpHVFDTsLPPEEITP 109 Amphimed...
EPB86330             18 QVRLSSTKANLAA-------TQNVIPTWNDYFKLRKKRRVYEVASYLPSTVAPAAGTF--------AYFLQ-MQVDPLTK 81  Mucor ci...
EXX77746             32 SISTNNSS------------PQQRKLTWNEYFVLRRKRRITERLVTIPTALGGFGISF--------AYFAS-KEFDP-TL 89  Rhizopha...
WGS:AFWA:PNEG_00496  30 ssiTNSKVDMFPR-------DSQDSLSWNEFLYLRRQNLRSGLIASIPSSLVGLSLGY--------FYFAT-IQVDPTQT 93  Pneumocy...
O94539               44 TYSTESIKQ-----------KKPQDLNWPTFLKLRKSRRIFETLTSIPTALTGLGLGS--------AYFLT-RTVDPTMT 103 Schizosa...
EKC99622             97 IFGFDPYMVYGGATFACMAFGWLLGPTVGNALFGVTHPKLSKGnpspLEVMDREFFNRIKSRRVDPSRQSMNNPSPDFYG 176 Trichosp...
EGN95765             91 IMGIDPLIFYSGCTVACMGMGYLVGPMIGAAGWRMTHRRAMNL----IEAKDREFHKRIVKNRVDPTAQSATNPVPDFYG 166 Serpula ...
EMD38237            121 IFNIDPMYVYGFATLACAGLGYLIGPVVGSACWRMTHRRSMNL----IEKRDREFYNRIVKNRGDPSAQSATNPVPDYYG 196 Gelatopo...
P0CP48              106 IFGVEPMFVYGGATLGCMALGYLIGPSVGATLFSLTHPSIARGnpapLEVMDREFYHRIRKNRADPRFQSVQNIVPDFYG 185 Cryptoco...
EDO40484            129 ILGMDPLIFCGLCGVASAGVGYIAGSAIFGSIWRFFNRDTSKM----LQERESDFLERITAKRA----SSFSKFEDDYYG 200 starlet ...
XP_003386933        110 ILGMDPIVFAAVCGAASGMVGFILGGAFFNAVWKMV-SSKAKQ----IEKRDADFLSRLQRHRY--VGTDQNKYEDDYYA 182 Amphimed...
EPB86330             82 VLGMDPLMAAVASTLAAGFGGFLMGPVVGNAFFKLMNGKVVQA----MDVRDKEFYEHIKKNRADARLNSIRNPVPDYYG 157 Mucor ci...
EXX77746             90 IWGHDPLVIYGFGTILCGFTGLMIGPVIGSSIWKLFHRREVEL----MEQSDRDFYAHIKKNRADPSLHSLRNPAPDYYG 165 Rhizopha...
WGS:AFWA:PNEG_00496  94 IFGIDPFVVYLLATLASGGAGWLLGRPIGIALWKSFHFKRNKL----VQEKERDFFLHIQKNRVDPRYQSINNPVPDYYG 169 Pneumocy...
O94539              104 IMGLDLFTLYVIGTIASGGLGWLLGPSIGRKIWTLLHKSQARQ----IAAREQEFYRHLVKNRVTPQMESYSNPIPDYYG 179 Schizosa...
EKC99622            177 EKITSIPAYRQWLKDQKAYAAKVSH 201 Trichosporon asahii var. asahii CBS 8904
EGN95765            167 EKIGSLHQYKQWLRDQAKFRRKARl 191 Serpula lacrymans var. lacrymans S7.3
EMD38237            197 EKIGSLHNYRQWLRDQAKFKRKAyl 221 Gelatoporia subvermispora B
P0CP48              186 EKIVSLSTYRRWLRDQAVYKRKAMH 210 Cryptococcus neoformans var. neoformans JEC21
EDO40484            201 ENIKTLSDYRQWLREQQKKQKAADS 225 starlet sea anemone
XP_003386933        183 DKVLTLSDYRQWIRQQQRKKEAAAs 207 Amphimedon queenslandica
EPB86330            158 EKIQSVQDYRAWLRKQREHYRKgvf 182 Mucor circinelloides f. circinelloides 1006PhL
EXX77746            166 EKIKSVTDYRRWLRKQRDIIRKGtf 190 Rhizophagus irregularis DAOM 197198w
WGS:AFWA:PNEG_00496 170 EKIGSLSDYRRWLRDCRAYRKKApi 194 Pneumocystis murina B123
O94539              180 EKIYSLSDYRRWLRDQKAYIQRAfw 204 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap