Conserved Protein Domain Family
Lipid_DES

?
pfam08557: Lipid_DES 
Sphingolipid Delta4-desaturase (DES)
Sphingolipids are important membrane signalling molecules involved in many different cellular functions in eukaryotes. Sphingolipid delta 4-desaturase catalyzes the formation of (E)-sphing-4-enine. Some proteins in this family have bifunctional delta 4-desaturase/C-4-hydroxylase activity. Delta 4-desaturated sphingolipids may play a role in early signalling required for entry into meiotic and spermatid differentiation pathways during Drosophila spermatogenesis. This small domain associates with FA_desaturase pfam00487 and appears to be specific to sphingolipid delta 4-desaturase.
Statistics
?
PSSM-Id: 400734
View PSSM: pfam08557
Aligned: 68 rows
Threshold Bit Score: 60.5994
Threshold Setting Gi: 123853858
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q583N4        18 GRDDYYWTTDNEMHAVRRRKMLEKYsSEIKKLYGPDPL 55  Trypanosoma brucei
C4R613        24 pQFEFYWTRQKDPHSIRRKLILAKH-PEVAKLCGPEWR 60  Komagataella phaffii GS115
XP_011273834  27 KLNDFYWTNETEPHTIRRKLILKKY-PKITELCGPEPL 63  Wickerhamomyces ciferrii
CCE39968      27 VLNDFYWTNEAEPHALRRKLILAKH-PEVRKLTGYEPK 63  Candida parapsilosis
XP_002619999  26 VLNEYYWTKDAEPHVERRKAIMAKY-PQVSRLTGYEPK 62  Clavispora lusitaniae ATCC 42720
XP_007377206  26 VLNEFYWTKDPEPHIARRKLILEKY-PEVRKLNGYEPK 62  Spathaspora passalidarum NRRL Y-27907
Q5AJX2        27 VLNDFYWTDTDEPHVARRKMILQKY-PEVTKLTGHEPK 63  Candida albicans SC5314
XP_004202136  26 TLNEFYWTNESEPHVSRRKAILAKH-PEVKKLTGHEPK 62  Pichia farinosa CBS 7064
O59715        25 dVHQFYWTYTEEPHKSRRAAILKAH-PEIASLNGYEPL 61  Schizosaccharomyces pombe 972h-
ESS31038      69 tPQDFQWTTQPIPHSYRRRTILEKH-PEVEELFGYDVR 105 Toxoplasma gondii VEG
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap