Conserved Protein Domain Family
VID27

?
pfam08553: VID27 
VID27 cytoplasmic protein
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation.
Statistics
?
PSSM-Id: 400733
View PSSM: pfam08553
Aligned: 53 rows
Threshold Bit Score: 574.56
Threshold Setting Gi: 74695593
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P40157              418 KGNSSLTVAFRNNRSYVTRDNRIGVFKTDDEDDs--LEFVAAIKNISNLGGKSIDPHKPMLYMEDRNLILTDGE-NENKL 494 Saccharo...
Q6CA59              435 DKNKLLAVGTSNDRSYVVRGNRIGVFKNTADNE---LEFATTIENISKPDKTSFNPDKMMLHYQDKHIVLQDKS-EGNNL 510 Yarrowia...
Q6BUM7              500 DKNSNLSVGYANDRSYVVRGDKLGVFNNNNNN----LNYQTTISNLKTLDGKRFTPEQVMLHMQDQHMVMSNKDmDDKRL 575 Debaryom...
XP_003670926        441 DTNKSLTIAFKNNRSYVVRGNKIGVFKTDEDDD---LEFVTAIKSVSTLDGKTLDPRNPMLYMGDRSMILSDSS-TKNKL 516 Naumovoz...
CCK70768            435 SGNKSLTVSYRNNRSYILRGDKIGVFKTVDDDDdsgLEFVSVIKNVSNADGKKIDPKNPMMYMEDRSIILSDDK-NLNRL 513 Kazachst...
Q75E38              435 VGNKALAVGFKSDRTFVLRGDKIGVFKTSDADS---LDFVTAINEVSDIKGNVLNPNSAMLYTEDRALILQDEN-HKERL 510 Eremothe...
ybcl:Ecym_6451      465 SGNKSLTIGFRNDRSYVVRGNKIGVFKTNPDED---LEFVTSINNVSNLDGEILFPEKTMLYTEDRAMIIQDEK-EKDKL 540 Eremothe...
WGS:AATM:SJAG_02337 460 EQNSLLAVGYKNDRSYVARGNRIGVFKHTDDNQ---LKFQTAIENLQTSTGQKVRPKKIMLHNQDSSIVFQDER-IPNNL 535 Schizosa...
EPY50504            462 EKNSILAVGYKNDRSYVARNNRIGVFKHVDDG----LKFDTSINNLSKPNGKPLQPSKILLHNQDSSIVFQTED-SPHHL 536 Schizosa...
Q1MTR3              434 EHNSLLAVGYKNDRSYVVRNNKIGVFKHVDEKG---LKFQTALNNLSTPKGKSLRPSKLMLHNQDSSILFQTEN-APHSL 509 Schizosa...
P40157              495 YKMDIERGKVIEEWSTGDKN---VVQYGPTKKFDQMTPEQTIVGVSQKGVFKIDPRINGkNKIAVDESKDYVGKYNFSSI 571 Saccharo...
Q6CA59              511 YKMDLEYGKVVDEWKVSDDSkngVVSFAPSAKFAQMTGEQTFLGMANSGLFRIDPRLSG-SKLVDSEHKKYATNNQFSAL 589 Yarrowia...
Q6BUM7              576 YKMDLSRGKIVDEWEVDDIIp--IESYGPNSKFSQLTNEQTLTGMSRNKLFKVDPRLPT-TKLVQGDDNLRTPNYNFLAL 652 Debaryom...
XP_003670926        517 YKMDLERGQIVEEWSTGDKN---LVQYGPTKKFDQLTAEQTLLGISQKGLFKIDPRINTsNKVVQEQSKDYVTKYKFSSL 593 Naumovoz...
CCK70768            514 YKLDIERGKVIEEWGTGDKN---VVQYGPSKKYDQLTAEQTVLGISDKALFKIDPRINDeNKIVQDQSKEYASRNKFSSV 590 Kazachst...
Q75E38              511 FKMDLERGKVVEEWVAGGRD---VLQIGPNKKFDQLTSEQTFLGIAPNSVFQMDPRLSGqNKVVSSSDYSYSSVRDLRSL 587 Eremothe...
ybcl:Ecym_6451      541 YKMDLERGKIVDEWSANKQN---IMNYAPVKKFDQLTNEQTFLGISTDSIFRMDPRISGkNKLVTADAKQYHTNNKFCSI 617 Eremothe...
WGS:AATM:SJAG_02337 536 YHMDLERGTIVDEWKVHEDVp--VVTFAPDNKFAQMTPEQTLVGISNNSLFRIDPRQRG-SKVVNDQFKQYVTRNAFSAA 612 Schizosa...
EPY50504            537 YHMDVEYGKVVDEWKIHEDVp--LVAMAPDNKFAQMTAEKTLVGLSNNSIFRIDPRVEG-NKLVAEEFKQYATRNHFSTA 613 Schizosa...
Q1MTR3              510 YHMDIEYGKIVDEWKVHDDVp--LVTFTPDNKFAQMTAEQTLIGLSNNSIFRIDPRVEG-NKLVAEQFKQYATKNDFSSA 586 Schizosa...
P40157              572 GTTESGYIAIGSEKGDIKLYDRLGIRAKTAIPSLGQAIKFITTSADGKWLLATCESTLLLMDLKIKDG-KNAGNIGFLKS 650 Saccharo...
Q6CA59              590 TSTEGGHIAVASQKGEIRLFDRLGINAKTALPALGDPILGVDVSADGRWILATCKTYILLIDATIKDG-KYEGETGFKRS 668 Yarrowia...
Q6BUM7              653 STTEQGFLAVGSAKGDIRLFDRLGTNAKSLLPSLGEAIIGIDVSNDGRWILATCKTYLLLVDAKVGANqRNEGSLGYVKS 732 Debaryom...
XP_003670926        594 GTTESGYIAVGSERGDIKLYDRLGIRAKTAIPSLGEPIKHLIVSADGKWLLATCDRSLLLLDLTVKTG-KNSGNVGFLKP 672 Naumovoz...
CCK70768            591 GTTEGGYIAVGSEKGDIRLYDRFGIRAKTSIPSLGQPIRHICTSGDGRWLLATCDSSLLLMDLTVKTG-KNAGNIGFLKS 669 Kazachst...
Q75E38              588 CTTQLGYVAVGSNKGEIRLYDKLGKRAKTLIPALGEPIRHLCASADGKWLLATCKSSILLFDTEVKEG-RNAGALAYQKS 666 Eremothe...
ybcl:Ecym_6451      618 SSTESGLVAVGSEKGEIRLYNKINSRACTLIPALGQPIKHLCASADGKWLLATCQSNLLLIDTEIKTG-NNAGILGYNKG 696 Eremothe...
WGS:AATM:SJAG_02337 613 ATTEKGYIAVASSKGDIRLFDRIGINAKTALPALGEPIIGVDVTADGNWVLATCKTYLLLIDARIKEG-RYAGKLGFERS 691 Schizosa...
EPY50504            614 ATTEKGYIAVASDKGDIRLFDRLGINAKTALPALGEPIIGIDVTADGNWVLATCKTYLLLIDARIKEG-RNAGKLGFERS 692 Schizosa...
Q1MTR3              587 ATTENGYIAVASNKGDIRLFDRIGVNAKTALPALGEAIIGVDVTASGDFVLATCKTYILLIDTRIKEG-RYAGRLGFERN 665 Schizosa...
P40157              651 FPASENVKTYVLKIRPEHSASILTYT-KKPIRFTKAYFNTGIGQQEQTIVTSTGPYAISWSLKGILNQDGSnn-yPYRIR 728 Saccharo...
Q6CA59              669 FAKDAKPRPKRLQISPEHVAFMLAET-GSGLNFTKAHFNQGPNSREQTVVTSSGPYVVTWSLKKLLRGDAN----PYLIK 743 Yarrowia...
Q6BUM7              733 FDKDKKPKPRRLTIKPEHVAYMSMKTeGKPLQFTKAYFNTGIDSKETTIVTSTGPYIISWSLKKVLSNNSSkedqPYLIK 812 Debaryom...
XP_003670926        673 FPSSEVVKTYILKISPEHTSYISTFT-KKPVSFSKAYFNTGVGKQEEMILTSTGPFAVSWSLKKVIRGDKN----PYVIR 747 Naumovoz...
CCK70768            670 FPSTENVKTYILKISPEHASYMVTYT-KKPIKFSKAYFNAGVGQVEQTIVTSTGPFAISWSLDKILSGSAK----PYTVN 744 Kazachst...
Q75E38              667 FSQGALPQCYVLKVDPSTAIYMQTET-GAPIEFTKATFNTGLDTKEQTITTSTGPFAMVWPIKSILQGKKT----PYVIK 741 Eremothe...
ybcl:Ecym_6451      697 FSRDNMPNMYVLRLEPATAMYMQQQS-GQPINFTKATFNVSLNAKEHTISTSTGPFAMVWNLKDILSGKKT----PYIVR 771 Eremothe...
WGS:AATM:SJAG_02337 692 FSKNSKPKPKRLQLSPQHIAMMQSEL-QGSTSFTPGKFNTGIEATETTIVSSIGPYLITWNLERVKRGKTD----KYKIR 766 Schizosa...
EPY50504            693 FNKDSKPKPKRLQLSPQHVAMMQGEL-EGGVSFTTAKFNTGIDAQETSIISSVGPYLISWNLDFVKRGKTD----KYKIR 767 Schizosa...
Q1MTR3              666 FAKDKKPKPKRLQLSPQHIAMMQREL-KGGASFTPAKFNTGIDAKETTIVSSIGPFLISWNLDRVKRGFTD----SYKIR 740 Schizosa...
P40157              729 RYNADVVADNFEFGSDKKVIVALKDDVSLSKVKSFKQPSKGVLMPSASL 777 Saccharomyces cerevisiae S288C
Q6CA59              744 RYSDQVTAGDFRFGTDKNVIVATEDDVNMVSKKSFRKPTRESLATPGMR 792 Yarrowia lipolytica
Q6BUM7              813 RYDQNVIADNFKFGSNSDVIIALQDDVSMANKKNFRKANKSSLfsrdnv 861 Debaryomyces hansenii
XP_003670926        748 RYENDIVEDNFEFGTNKKVIVALKDDVSLSKIKSFKKPNKDVLMPKSSL 796 Naumovozyma dairenensis CBS 421
CCK70768            745 RYRSDVVEDNFEYGTDKKIIVALKDDVSLSKIKSFKNPSKMVLMPENNI 793 Kazachstania naganishii CBS 8797
Q75E38              742 KYHSNVTEESFKFGSDRNVIVALKDDISMAKKKSFRAPSRAMLTKMGKQ 790 Eremothecium gossypii
ybcl:Ecym_6451      772 KYDSNIMEEGFTFGSDKNIVVALKDDVSMAKKRSFRAPSKKLLVQSSSK 820 Eremothecium cymbalariae DBVPG#7215
WGS:AATM:SJAG_02337 767 RYEAEIKADDFRFGTDRNLIVTLPNDVAMIDKSSLRKPTRESICTPMRN 815 Schizosaccharomyces japonicus yFS275
EPY50504            768 RYQANIQAEDFRFGTDKNMIVALPNDVTMIDKSSLRRPTRASICTPASK 816 Schizosaccharomyces cryophilus OY26
Q1MTR3              741 RYDANVQAEDFRFGTDRSLIVALPDDVAMVDKSSLRRPTRESICTPVKK 789 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap