Conserved Protein Domain Family
SWI-SNF_Ssr4

?
pfam08549: SWI-SNF_Ssr4 
Fungal domain of unknown function (DUF1750)
This is a fungal domain of unknown function.
Statistics
?
PSSM-Id: 400730
View PSSM: pfam08549
Aligned: 28 rows
Threshold Bit Score: 794.294
Threshold Setting Gi: 407928386
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_007811612          5 DPSHTVPQDLMPHVHLVSSYRYPTMPRIDMNEVAKWLMTAPQIARDRAPFFWTYLDKPA-DGTVLLTWQPLQRLGTNFAT 83  Metarhiz...
EKG21244              3 DPSFGVPQFLLPHVHLISSYRYPTLATLSIEQAVDFLLNAPKIVKDVAPMTWQYFQNPPnDGTVFLEWQPVNQRGNAYAS 82  Macropho...
GAD93651              3 DPASGLPGQLLPHMHLVSRYRYPMMSVLPTETAVDYLLSASKIVRELQPMHWTFLDGPP-DGTVMLTWQPLNHLGTNFAS 81  Byssochl...
EED22084              3 DPAGGLPGQLVPHMHLVSRNRYPAMTALPTETVLDYLLAAPKVVRDMYPMAWTFLDGPQ-DGTTLLTWQPLANLGTTFAS 81  Talaromy...
XP_002146756          3 DPAGGLPAQLVPHMHLVSRNRYPAMTALPTETVLDYLLAAPKVVREMYPMSWTFLDGPQ-DGTTLLTWQPLGHLGTTFAS 81  Talaromy...
EPS32040              3 DPASRIPGQLLPHMHLVSRNRYPNMHMMPTETALEYLLSAPRTC-QTQPMQWTFLDGPQ-DGTVMLTWQPLNHLGNNFAS 80  Penicill...
Q4WMY0                3 DPASRVPAQLLPHMHLVSRHRYPLMHMMPTDTVVEYLLSAPKIVREAQPMHWTFLDGPQ-DGTVMLTWQPLNHLGTNFAS 81  Aspergil...
Q0CKG4                3 DPAARVPGQLLPHMHLVSRHRYPLMHMMPTDTVVEYLLSAQKIVREAQPMHWTFLDGPQ-DGTVMLTWQPLNHLGTNFAS 81  Aspergil...
XP_001394178          3 DPASRVPAQLLPHMHLVSRHRYPLMHMMPTDTVVEYLLSAPKIVREAQPMHWTFLDGPQ-DGSVMLTWQPLNQLGTNFAS 81  Aspergil...
WGS:ACPH:TERG_02789   3 DPAGGVPPQLLPHLHLVSSYRYPASAAFTHETAVEYLLAAPKVVRELQPMHWTYLDGPP-DNTVMLTWQPLNHLGTNFAS 81  Trichoph...
XP_007811612         84 DGFVWAPPEQVYKHDLGNGLILEIYYLKAGYIPG-EQFALHTRRRFRLVp-TPGHPNPPPLDMSLFIVHYGPSEQNDRVP 161 Metarhiz...
EKG21244             83 DGYVWADPESSYSYESQRGYTVEILVRRSGYRPGfEQVTCHQRHRYRIAs-RNPASQGPIPDQALFVVHYSQAEPQARVP 161 Macropho...
GAD93651             82 DGFVWADAEQAFTFEA-KGYTVEMWLHRSGYHPPnENLATHCRRRFRLVaaKAPNPNLPPPDPSLWIVHYSKAPPTDHIP 160 Byssochl...
EED22084             82 DGYVWADAEQAFTFET-RGYTIEMWVQRSGYHPPqETVASHSRRRYRLVpsKVP-SNAPSPDPSLWIVHYARASQNDMIP 159 Talaromy...
XP_002146756         82 DGYVWADAEQAFTFET-RGYTIEMWVQRSGYHPPqESIASHSRRRYRLIpsKVP-PNAPQPDPSLWIIHYARAAQNDIIP 159 Talaromy...
EPS32040             81 DGYIWADVEQAFTFEA-RGYTVEMFIHRSGYHPPnENLATHSRKRYRIVssKVP--NAPAPDPSLWIVHYSRAPQQDHIP 157 Penicill...
Q4WMY0               82 DGYVWADVEQAFTFEA-RGYMVEMWLHRSGYHPPnESVAIHCRRRYRLLptKVPNPSLPPPDPSLWIVHYSRAPPTEHIP 160 Aspergil...
Q0CKG4               82 DGYVWADVEQAFTFEA-RGYAVEMFLHRSGYHPPnESMAIHCRRRYRLLpgKMPNPNMPPPDPSLWIVHYSRAPPTDHIP 160 Aspergil...
XP_001394178         82 DGYVWADVEQAFTFEA-RGYLVEMWLHRSGYHPPnETLAIHCRRRYRLLpsKVPNPNVPPPDPSLWIVHYSRGPPTDHIP 160 Aspergil...
WGS:ACPH:TERG_02789  82 DGYVWADVEQAYTVEV-RGYILEIYMHRTGYHPPnETMATHSRRRFRITglKTPNPNLPPCDPSLWIVFYSKAPSIDQLP 160 Trichoph...
XP_007811612        162 ANMVPYDERVNAIMQQRHFLLRGGQIRRKEFMLSDRVNWPSLPEL----------TRq---QMGPQMAP------RGvpq 222 Metarhiz...
EKG21244            162 TNRIPINAEMQKMMQERRFLESQGQLMEKRFMLHDRHNWPNISFPgtgqmqqghvQPg--gMYPGHPIQagagafRQ--- 236 Macropho...
GAD93651            161 ANRIPILPQTQSMLAQRRFLQGQGQLVRKDFMLHDRNNWPTINFPpqmgp-qgfsQPp--gAFPNAMMA------RQp-- 229 Byssochl...
EED22084            160 AQRIPITPQVQTTLAQRRFLQTQGQLVRKEFMLHDRNSWPTITFPaqmga-qgfaQPq--aYYANAG--------RQppp 228 Talaromy...
XP_002146756        160 AQRIPVTPQVQTTLAQRRFLQTQGQLVRKEFMLHDRNNWPTITFPaqmga-qgfaQPq--aYYANAGPA------RQppp 230 Talaromy...
EPS32040            158 ANRIPITPQVQNVMGQRRFLQSQGQLAHKDFLLHDRNSWPTVRFPpqmpp-qgfaQPqpgpPYSSTQPG------RP--- 227 Penicill...
Q4WMY0              161 ANRIPVSPQVQNMLAQRRFLQNQGQLARKDFMLHDRNNWPTINFPpqiap-qalaQPa--gPYPNAMVG------RQ--- 228 Aspergil...
Q0CKG4              161 ANRIPILPQVQATLAQRRFLQSQGQLARKDFMLHDRNNWPTINFPpqmap-qgfqQVp--gPYPNPMAG------RQ--- 228 Aspergil...
XP_001394178        161 ANRIPIMPPVQNMLAQRRFLQSQGQLARKDFMLHDRNNWPAINFPpqmap-qgfpQVp--gAYPSAMVG------RQ--- 228 Aspergil...
WGS:ACPH:TERG_02789 161 TSRIPVSPQTQNILGQHRYIQSQGQLARKEFMLHDRNNWPTINLPphgqqqppypQP-----YAAQMIA------RQq-- 227 Trichoph...
XP_007811612        223 QMAYPPQ-PAPGPPA--------KR-A---RHSQSQSQQQqqqqqqqqqhqqqqptvpgmNPMDSA--FDDEEDISRGDM 287 Metarhiz...
EKG21244            237 PQFYPPGqGSAIGPSpakrprqvPPaHlpgNAPAGMPPAA--------------------VAMGHDtsIEDEENVALGDL 296 Macropho...
GAD93651            230 GAFYPPQqATGIPGAmapaqakaPRgH---RGSTAALSAA--------------------NA---DfsLEDEE-VSTGDM 282 Byssochl...
EED22084            229 GAYYPPPqP---GMPagqvpvkaPRgH---RTSAGSVAGA--------------------AA---EfsMEDED-ASTGDI 278 Talaromy...
XP_002146756        231 GAYYPPQqP---GVPagpapvkaPRgH---RTSAGAAAVA--------------------AA---DfsLEDED-VSTGDL 280 Talaromy...
EPS32040            228 -GFYPAQ-AHPAAAPpapaqgkaPRaA---RAPSAAMAAV--------------------AA---DfaLEDED-VSSGDA 278 Penicill...
Q4WMY0              229 -PFYPQP-GQPAPPPaaaapakaPRgH---RASTAAMTAA--------------------AA---DfaLEDED-VSTGDL 279 Aspergil...
Q0CKG4              229 -PFYPPP-GPGMPAPapavpakaPRgH---RASSAAMNAA--------------------TA---DfaLEDED-VSAGDM 279 Aspergil...
XP_001394178        229 -QFYPPP-GPGVPPPaaatpakaARgH---RASSAAVNAA--------------------TA---DfaLEDED-VSTGDA 279 Aspergil...
WGS:ACPH:TERG_02789 228 VPHAPMQqQQVVGYPpgvvppkaQRtQ---RLPTAAAPAV------------------------PDfsLDDEE-VSTGDI 279 Trichoph...
XP_007811612        288 FDHLTPREISLHRYQQNHEWMEEILSSAYRIGQIQPSDLNLGLKGELASLTEGIFT----AQGGDVFTQSPEKPYVGRLD 363 Metarhiz...
EKG21244            297 LDHLTPRDISTMRYIQHHEWMEEVFSSPYAAGQIMPVDLGLGLMGELAHLTEGLFDapsaSSLPGGQKAPEAPKPYQKLS 376 Macropho...
GAD93651            283 LDLLTPREIAKMRYQQHHEWMEEIFASPYATNQITPVDLGLGRKGELESLTAGFFDaptgPSAPKESKA------AGKME 356 Byssochl...
EED22084            279 LDVITPREISKMRYQQHHEWIEEVFASPYTIKQITPVDLGLGRKGELESLTSGFFEapvtSTHPKDGPNTA--LKEGKME 356 Talaromy...
XP_002146756        281 LDMLTPREISKMRYQQHHEWMEEIFASPYTIRQIIPVDLGIGRKGELESLTAGFFEapvsSTHPKDDKESSVALQGGKLE 360 Talaromy...
EPS32040            279 MDFLTPREISKMRYVQHHEWMEEIFGSHYAISQITPVSLGLGRKGELESLTTGFFDapagGEGQEGQAPD-----ATKLE 353 Penicill...
Q4WMY0              280 MDLLTPREVSKMRYQQHHEWMEEIFASPYAISQITPVSLGLGRKGELETLTAGFFDapvgPAGGDSKEGTESAQ-ATKME 358 Aspergil...
Q0CKG4              280 MDLLTPREVSKMRYQQHHEWMEEIFASPYAISQITPVSLGLGRKGELESLTAGFFDapaaPTTGEHKEEPVA---ATKME 356 Aspergil...
XP_001394178        280 MDLLTPREISKMRYQQHHEWMEEIFASPYAINQITPVSLGLGRKGELESLTAGFFDapvgPASGETKDANTSTQAAEKME 359 Aspergil...
WGS:ACPH:TERG_02789 280 LDALTPRDISRMRYKNHHEWMEEVLASPYRMDQILPVDLGLGRKGELESLTKRYFYtp-gALASQRKEGDGPPPATGKMD 358 Trichoph...
XP_007811612        364 PGLADEFRKRVCKHVESTESEIKKLQEEHAELMASFKQNSALKIKEKQIRSIpdppvp---eifkaEDRS---DNVEEQR 437 Metarhiz...
EKG21244            377 KEKYQDFEERINSFLKNEEAELEKMKAEHAKKMAELTKSKTYVQAERLLRDAaf-----------sDSRKaapATESQSA 445 Macropho...
GAD93651            357 PGKAEEFADRVAKKVADMTEEIEKLKKRHARRMEKFKRTSLLKDAEYRLRDAaadpdatgselwrlEGRIdtsTE--EGA 434 Byssochl...
EED22084            357 PEKAEEFADRVAKKVSDMTAEIEKLKRRHERRMQKIGRVSVLKDAEQRLREAganpsetgrevwrlEGRIdtsTEE-EVP 435 Talaromy...
XP_002146756        361 PEKAEEFADRVAKKVSDMTAEIEKLKRRHARRMAKIGRMSVLRDAELRLREAganpsetgpeiwrlEGRIdtsNEE-EAP 439 Talaromy...
EPS32040            354 PAKAEEFADRVAKKVADMTAEIEKLKKQHARRMERFNRSSLFKDAEIRLRAAaadpsvtgsevwrlEGRIiipNEDGETP 433 Penicill...
Q4WMY0              359 PERAKEFADRVAKKVADMTAEIEKLKKRHARRMEKFNRTSLLKDAELRLRDAaanpedtgteiwrmEGRTemsTEG-DEA 437 Aspergil...
Q0CKG4              357 PAKAEEFADRVAKKVADMTAEIEKLKKRHARRMEKFNRTSLLKNAEFKLREAaadpeelgtevwrlEGRIvvpTEDEDET 436 Aspergil...
XP_001394178        360 PAKAEEFADRVAKKVADMTAEIEKLKKRHARRMEKFNRTSLLKDAELRLREAatdpaetgtetwrlEGRVvmpSED-DDS 438 Aspergil...
WGS:ACPH:TERG_02789 359 PGKAEEFANSVAKRLAEMNAEMESMRKKHARKLEKTKKLSALREAELNLRDAvidpsdtgdeiwrvEGRLrleQE--EGM 436 Trichoph...
XP_007811612        438 APALQP------EKTPFDDILKDVEASIGRKIDIHPVIKRVQDGGYQAPapkpptpgpttqmSRQPSQSGSQNSGLMMGD 511 Metarhiz...
EKG21244            446 SPFSEGa----dPDVKVNEVVEDVEKSLGVTIAPRKNVNCVEKGGLVDE-------------PPAPAQTGNEANGTENGA 508 Macropho...
GAD93651            435 SPVEQTqp---kPKYKVDDILHEVETSWGKKIVPETKVACVEKGGLLEKi-----------eHEQPEPEG---------- 490 Byssochl...
EED22084            436 TESPLEdisvrvPQYRVDEVVKDLEKAYGKTIVPDPSITCVEKGGLLERie----------aSPAPEDITGA-------- 497 Talaromy...
XP_002146756        440 IEETVEdislrmPRYRVDDVVKDLEKAYDRAVLPATSITCVEKGGLLERie----------pTPQPEENAGA-------- 501 Talaromy...
EPS32040            434 QLDYVEe----kAKFKVDDVVRDVEQTWKKQIVPMPKVSCVEKGGLLEKie----------pEQKMEPESFAN------- 492 Penicill...
Q4WMY0              438 EVVPVEh----kAKYKVDDIVREVEASWRRKIVPEPRVSCVQKGGLLEKi--------------ePEPVSTAADV----- 494 Aspergil...
Q0CKG4              437 EPRPVSdp---kAKFKVDDVVKEVEQAWQKPIVPEPKVSCVQKGGLLEKie----------pERKEEPTGG--------- 494 Aspergil...
XP_001394178        439 QAPQVEn----pAKYKVDDIVREVEKSWQRQIVPEPKISCVQKGGLLEKie----------pEQKPEPQAEG-------- 496 Aspergil...
WGS:ACPH:TERG_02789 437 SPVDYSdk---sLKKKVDDIVNGLQASWGRTVVPVTDIKCVEKGGLQERv-----------qPPPPPPQPAIS------- 495 Trichoph...
XP_007811612        512 S------DMDMG-----GTAAGLLDQMh---------TGF-SSTSTPVN-NFPTPQAQVSAAQSNAPTP-SNVhNIPSPA 568 Metarhiz...
EKG21244            509 TngesngGLDDSamdgdNTAAGLLDQYt--------sNSL-VSTPGGSSlQVPPVSQPDSQGQSATATPgGSAqPGHTHE 579 Macropho...
GAD93651            491 -------DVSME-----NADSHLLDQFgtpag-stpgQGAtSQAGGTT-----------------------AAgPGNAPN 534 Byssochl...
EED22084            498 -------DTDM------LMETSILDQFvasst-sppgQGS-QQAAVSTA----------------------------VPA 534 Talaromy...
XP_002146756        502 -------DTDM------LMENSILDQFvasst-stpgQAT-QQAPVSAG----------------------------VPA 538 Talaromy...
EPS32040            493 -------DMAVD-----QTGSHPTDQFg------------pSTAASNT--------------------------VPPVPP 522 Penicill...
Q4WMY0              495 -------DIDMG-----HTDSHLLGQFgapsq-gvapAAQgQAVPTAT-----------------------------GPA 532 Aspergil...
Q0CKG4              495 -------DVDMG-----QVESNLLDQFstlpstesvpTAQaQAGQPPA-----------------------------APP 533 Aspergil...
XP_001394178        497 -------DIDME-----NADSHFLDQLgspsaagavpASStTQEPTAP-----------TAVPGVPPTTsVPSgGVSVPP 553 Aspergil...
WGS:ACPH:TERG_02789 496 -------DANM------------INTLhysqydgatdGGA-EAAPGAS-------APAQGVPTSAPSQPiVSSvAPPQPV 548 Trichoph...
XP_007811612        569 PALPTVpeag----pgsaRPSHSHPAGDVDMSGMGAhskaq-gdsaADQGTDSGDWVVV---PKGGAspdgnapssavss 640 Metarhiz...
EKG21244            580 QDQSGSgvqsdnsngdngMDLIENMDLDIDMSGMGE----------GANDKAADDWVMVdsnNNGGN------------- 636 Macropho...
GAD93651            535 AASAQAsttgt---sqggIPSVPDLDVDIEMAGTSNdq------qaPTADGETGDWVMV---NDDTK------------- 589 Byssochl...
EED22084            535 TQPT--------------------GDGDVEMGGATNaltq-----sgtAAGETGDWVVV---ENENSg------------ 574 Talaromy...
XP_002146756        539 QPATHAp-----------------GDGDVEMGGATNapvq-----sgtAAGETGEWVVV---ENENT------------- 580 Talaromy...
EPS32040            523 APQASK-------------------DVEMDMGNQAGg---------GGTTAESGDWVMV---NKENK------------- 558 Penicill...
Q4WMY0              533 PAQPTV-----------------SLDAEMDMGDGQPt---------NTAVGETGDWVMV---NEDKK------------- 570 Aspergil...
Q0CKG4              534 VAHASTt----------dAAQAGGLDVEMDLGDGKP----------GTAAGETGDWVMV---PEEKK------------- 577 Aspergil...
XP_001394178        554 QPQPTAd----------aTQQGASLDIDMDMGDAQAt---------NTAAGETGDWVMV---NDEKK------------- 598 Aspergil...
WGS:ACPH:TERG_02789 549 ITAPQT-------------------SEDVVMGGVEPstqshatpgqPAAAEGDGDWVMV---NKDGQassaspskdlgst 606 Trichoph...
XP_007811612        641 aaVTAPTAAVPIAaptvtVgaTSGQVAQQKLAPVPTKPISAAATPAVtdggsasfDQNDFSSLgdlDTAGDAMAGYdapd 720 Metarhiz...
EKG21244            637 --GSGEAGQNKSSsttggGdnDTTIAQGQDGTTTSAPASAAGNTPGMf-------DATDFSAF---DTAGDALADY---- 700 Macropho...
GAD93651            590 --------KDQAG---------EGDKSSAQGFTPG---------NTGlets-nfdDAADFTNI---DSAGDALAAYs--- 636 Byssochl...
EED22084            575 --NVPSVTADKP--------------------ITN--NAPTGGETSGvets-nfdDAANFTNL---DSAGDALAAYd--- 623 Talaromy...
XP_002146756        581 -----AVLTDKP--------------------TTN--NVPVGRETvets---nfdDAANFTNM---DSAGDALAAYd--- 624 Talaromy...
EPS32040            559 ---------DANT-------------------TPG-----ATVGESGiesa----nfdDFTNI---DSAGDALAAYt--- 595 Penicill...
Q4WMY0              571 --------DDNINrppgdMqaGETPGSGLQGLTPG----PGSAGDTGldsa-----nfdFTNM---DSAGDALAAYt--- 627 Aspergil...
Q0CKG4              578 --------ADKPT---------ATSGNGLQGLTPG---NTGSAGDSAldga-----nfdFTGM---DSAGDALAAYt--- 626 Aspergil...
XP_001394178        599 ---------DQPAggdssLpgISTPGSGIQGLTPG---NGGSAGDSAldga-----nfdFTNM---DSAGDALAAYt--- 655 Aspergil...
WGS:ACPH:TERG_02789 607 vnES----TQQPTst--aGapSTTTAGGTTATVPAAEATVPGTTPGAtge-------feDENI---NTAGEALADYh--- 667 Trichoph...
XP_007811612        721 ldgsaggLGE-DLDLQmdMDDSAFGDAFH-VDSSGT 754 Metarhizium acridum CQMa 102
EKG21244            701 -------TGGdDLDLG--LEGDAFGDAFHgTETRND 727 Macrophomina phaseolina MS6
GAD93651            637 ------eQND-GLDLPd-LENSAFGDAFHaSDNEHS 664 Byssochlamys spectabilis No. 5
EED22084            624 ------dQHD-GLDLPd-LENSAFGDAFHaSDHEMG 651 Talaromyces stipitatus ATCC 10500
XP_002146756        625 ------dQHD-GLDLPd-LENSAFGDAFHaSDHEMG 652 Talaromyces marneffei ATCC 18224
EPS32040            596 ------eQND-GLDLPd-MDNSAFGDAFHaSDNEHS 623 Penicillium oxalicum 114-2
Q4WMY0              628 ------eQNE-GLDLPd-LDNSAFGDAFHaSDNEHT 655 Aspergillus fumigatus
Q0CKG4              627 ------eQND-GLDLPd-LENSAFGDAFHaSDNENM 654 Aspergillus terreus NIH2624
XP_001394178        656 ------eQNE-GLDLPd-LENSAFGDAFHaSDNENT 683 Aspergillus niger CBS 513.88
WGS:ACPH:TERG_02789 668 ------gDVG-GLDMGg-IDDSAFGDAFHaTEGNIG 695 Trichophyton rubrum CBS 118892
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap