3VI1


Conserved Protein Domain Family
Peptidase_M10_C

?
pfam08548: Peptidase_M10_C 
Click on image for an interactive view with Cn3D
Peptidase M10 serralysin C terminal
Serralysins are peptidases related to mammalian matrix metallopeptidases (MMPs). The peptidase unit is found at the N terminal while this domain at the C terminal forms a corkscrew and is thought to be important for secretion of the protein through the bacterial cell wall. This domain contains the calcium ion binding domain pfam00353.
Statistics
?
PSSM-Id: 400729
View PSSM: pfam08548
Aligned: 14 rows
Threshold Bit Score: 303.475
Threshold Setting Gi: 502228769
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3VI1_B          248 ANLTTRTGDTVYGFNSNTERDFYSATSSSSKLVFSVWDAGGNDTLDFSGFSQNQKINLNEKALSDVGGLKGNVSIAAGVT 327 Pseudomonas ...
IEC:ABF-0020371 260 ANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGNDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVT 339 Dickeya dada...
IEC:ABF-0020373 258 ANMTTRTGDTVYGFNSNTDRDFYTATSSSKALIFSVWDAGGNDTFDFSGYSNNQRINLNEGSLSDVGGLKGNVSIAHGVT 337 Dickeya dada...
Q7N8R3          255 ANNTIRADDTVYGFNSNTDRDFYTAKDENSKLLFTAWDTGGNDTFDFSGFTQDQRINLNEASFSDVGGLKGNVSIARGVT 334 Photorhabdus...
CBJ92050        256 ANMETRKGDTVYGFNSNTDRDFMTATDANSKLIFSVWDAGGEDTFDFSGFTQNQRINLNAGSFSDVGGLKGNVSIARGVV 335 Xenorhabdus ...
CAR40753        258 ANTTTRTGDDVYGFNSNTGIDYYTATDSNDKLIFSVWDSGGNDTFDFSGFYQDQLIDLRAGNFSDVGGLQKNVSIAQNVT 337 Proteus mira...
Q4KBR8          266 ANYSTRAGDTTYGFNSNTGRDFYSASSSSDKLVFSVWDGGGNDTLDFSGFTQNQKINLNEASFSDVGGMVGNVSIAQGVT 345 Pseudomonas ...
WP_012738115    218 ANLETRIGNTIYGFNSNSGRPYLSAENADDPLIFCVWDAGGIDTFDFSGYRQNQRINLKSSQFSDVGGLKNNVSIAYRVI 297 Candidatus H...
CCH:MU9_1121    260 ANYNIRTDDTVYGFDSNTGRDYYSAQNATDKLIFTVWDGGGNDTLNFSRYKQDQKISLREGDFSDVGGLTGNVSIAHGVV 339 Morganella m...
Q6D3F9          258 ANMDTRTGDTVYGFNSNTGRDFYTTNSNSQKLIFSVWDAGGNDTFDFSGYKDNQIIDLNEGRFSDVGGLKGNVSIAHGVT 337 Pectobacteri...
3VI1_B          328 VENAIGGSGSDLLIGNDVAN------------------------------------VLKGGAGND--------------- 356 Pseudomonas ...
IEC:ABF-0020371 340 IENAIGGSGNDILVGNSADN------------------------------------ILQGGAGND--------------- 368 Dickeya dada...
IEC:ABF-0020373 338 IENAIGGSGNDLLIGNNADN------------------------------------ILRGGAGDD--------------- 366 Dickeya dada...
Q7N8R3          335 IENAIGGSGNDVLIGNDAAN------------------------------------TLKGGAGDD--------------- 363 Photorhabdus...
CBJ92050        336 IENAIGGSGDDILVGNSADN------------------------------------ILKGGAGDD--------------- 364 Xenorhabdus ...
CAR40753        338 IENAIGGFGNDIIHGNDADN------------------------------------TLIGGEGDDiiygh---------- 371 Proteus mira...
Q4KBR8          346 VENAIGGSGNDLLIGNNAAN------------------------------------VLKGGAGND--------------- 374 Pseudomonas ...
WP_012738115    298 IENAISGSGDDEIIGNEVDNvlrggkgadliygeqgcdrlfgeegndrlyggegadKLVGGRGSDqlwggkdndyllgge 377 Candidatus H...
CCH:MU9_1121    340 IENAFGGRGNDVIIGNDADN------------------------------------ILMGNGGND--------------- 368 Morganella m...
Q6D3F9          338 IENAIGGSGNDIIIGNSADN------------------------------------ILQGGA------------------ 363 Pectobacteri...
3VI1_B          357 ---------------------------------------ILYGGLGADQLWGGAGADTFVYGDIAESS-AAAPDTLRDFV 396 Pseudomonas ...
IEC:ABF-0020371 369 ---------------------------------------VLYGGAGADTLYGGAGRDTFVYGSGQDST-VAAYDWIADFQ 408 Dickeya dada...
IEC:ABF-0020373 367 ---------------------------------------ILYGGGGADRLYGGSGRDTFVYTAVSDSK-VAAPDWILDFQ 406 Dickeya dada...
Q7N8R3          364 ---------------------------------------IIYGGLGADNLWGGEGNDTFVYLSAKESP-PLERDWIHDFV 403 Photorhabdus...
CBJ92050        365 ---------------------------------------IIYGGLGGDHLWGGEGNDIFVYLSGKESL-KNNPDWIHDFV 404 Xenorhabdus ...
CAR40753        372 -----------------------------------sgnnTIYGGRGQDTLHGGTGSNTFIYKEIADSL-VSAADKIMDFK 415 Proteus mira...
Q4KBR8          375 ---------------------------------------IIYGAGGADQLWGGSGSDTFVFAASTDSK-PGAADQIMDFV 414 Pseudomonas ...
WP_012738115    378 dqdflfggqgndplvggrgrdqlwgekgddtllgemgddWLSGGIGSDKLTGGPGRDIFVYQTCDDSS-TLSTDTICDFE 456 Candidatus H...
CCH:MU9_1121    369 ---------------------------------------VLYGGAGQDQLWGGTGNDIFVFSAVTDSL-YDHPDHIRDFS 408 Morganella m...
Q6D3F9          364 ---------------------------------------------GADTLTGGAGKDIFVYASASDSSnTTGYDTITDFQ 398 Pectobacteri...
3VI1_B          397 SGQDKIDLSGLDAFVNgglvLQYV-DAFA-GKAGQAILSYDAASKAGSLAIDFS-----GD-AHADFAINLIGQATQ-AD 467 Pseudomonas ...
IEC:ABF-0020371 409 KGIDKIDLSAFRNEGQ----LSFVqDQFT-GKGQEVMLQWDAANSITNLWLHEA-----GH-SSVDFLVRIVGQAAQ-SD 476 Dickeya dada...
IEC:ABF-0020373 407 TGVDKIDLSALNTGNN----LHFV-NQFS-GSGGEILLNWDSSASVSNLYLNLD-----NN-TSPEFLVKIVGQVSQtAD 474 Dickeya dada...
Q7N8R3          404 SGKDKIDVSLFDLGEAgkggVKFV-REFT-GEVGEAVLRYNTVDKVNDFAINLG-----GEfSYDDFWVKIVGEPILeSD 476 Photorhabdus...
CBJ92050        405 SGEDKIDLSDFNFGGDg--dIKFV-DSFS-GKAGEVLFTYDEENDVTDLEISLG-----GDlAGNDFLVKVIGQPLTeAD 475 Xenorhabdus ...
CAR40753        416 TGIDKIDLSTLIQDTFsskiLNFV-DNFT-GNAGEATLSYNEVTNASELAINAY-----GYnYNPDFKIDIVGFVNYeTD 488 Proteus mira...
Q4KBR8          415 SGLDKIDLTGITKGAG----LHFV-NAFT-GAAGDAILT--TSGGVSTLSVDFS-----GH-GVADFLVSTVGQAAV-SD 479 Pseudomonas ...
WP_012738115    457 VGIDKIDLSRITNNIKn---IQFV-DRFHfKGQTEIQQRHNSILNITYLMIDFSdsiekNSlNNNDMMIKFTGNKKLtAN 532 Candidatus H...
CCH:MU9_1121    409 TGLDSIDLQGLNQNSAgekfIYFT-DEFT-GAAGAAELRYNEGLNLTELLINIS-----GDpYNYDFRVDITGQVNVhTD 481 Morganella m...
Q6D3F9          399 RGIDKIDLSALNQNKD----LQFV-DSFT-GLGNEALLDWDAGSNTTNLWLNFA-----GQ-TTPDFLVHIVGQPSAaTD 466 Pectobacteri...
3VI1_B          468 IVV 470 Pseudomonas aeruginosa
IEC:ABF-0020371 477 IIV 479 Dickeya dadantii 3937
IEC:ABF-0020373 475 FVV 477 Dickeya dadantii 3937
Q7N8R3          477 F-I 478 Photorhabdus laumondii subsp. laumondii TTO1
CBJ92050        476 FIV 478 Xenorhabdus nematophila ATCC 19061
CAR40753        489 FIV 491 Proteus mirabilis HI4320
Q4KBR8          480 -IV 481 Pseudomonas protegens Pf-5
WP_012738115    533 DFI 535 Candidatus Hamiltonella defensa
CCH:MU9_1121    482 FIV 484 Morganella morganii subsp. morganii KT
Q6D3F9          467 FIV 469 Pectobacterium atrosepticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap