Conserved Protein Domain Family
KorB

?
pfam08535: KorB 
KorB domain
This family consists of several KorB transcriptional repressor proteins. The korB gene is a major regulatory element in the replication and maintenance of broad host-range plasmid RK2. It negatively controls the replication gene trfA, the host-lethal determinants kilA and kilB, and the korA-korB operon. This domain includes the DNA-binding HTH motif.
Statistics
?
PSSM-Id: 400718
View PSSM: pfam08535
Aligned: 6 rows
Threshold Bit Score: 116.43
Threshold Setting Gi: 81597555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5NGD7        157 NKNVKKSDIAKILGRDNSWISMRLKIADANADIRELSNRGIIDDVRTLYELKKFAEEIPQGAQEFVkkaLENKISGSYRS 236 Francisella tu...
Q0VMS5        150 SKGWKVTDIAKQLGKNKSWLARYRLLYQSNDALKTLYTSGLCRDVNALVELARAQDKHPADVSRFIq-eALSGEATLSRS 228 Alcanivorax bo...
CBJ92870      134 EDGWKQKDIADRLGKNITFVSTHLSLLKLPDCVRELYDNEVCSDTETLNNLRLLFDMNEERCRAVC---AVAMSDGITRK 210 Xenorhabdus ne...
jgi:Swit_4936 136 ADGKNQAEIAKALGRSKQFVSLYAAYGEMEPYLRDAID---KAPIRVLYDLHRAARKHPLEVRDFV---RGFGERGVTLA 209 Sphingomonas w...
jgi:Swit_4975 136 GAGVTQAEIARALGRSKQFVSLYAACADMAPWLRAAID---QMPIRLLYDLHRAARTHGDAVRAYV---ERLGDENVTLA 209 Sphingomonas w...
WP_007688045  136 kGGMNQVEIAAALGRSKQFVSLYAAYGDMPAYLKAALP---FAPIRLLYDLHRTARDYPAEVEAYV---ASWGDAGATLA 209 Sphingomonadaceae
Q5NGD7        237 AItryRDNWKRKAE 250 Francisella tularensis subsp. tularensis
Q0VMS5        229 AV---QGFLNSLKG 239 Alcanivorax borkumensis SK2
CBJ92870      211 QS---RELLNDAKR 221 Xenorhabdus nematophila ATCC 19061
jgi:Swit_4936 210 EG---TKFVTSLKV 220 Sphingomonas wittichii RW1
jgi:Swit_4975 210 EG---GRFIAGLKA 220 Sphingomonas wittichii RW1
WP_007688045  210 AG---SRFIAELKQ 220 Sphingomonadaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap