4N2M,5HP5,1WD9


Conserved Protein Domain Family
PAD_M

?
pfam08527: PAD_M 
Protein-arginine deiminase (PAD) middle domain
This family represents the central non-catalytic domain of protein-arginine deiminase. This domain has an immunoglobulin-like fold.
Statistics
?
PSSM-Id: 400711
View PSSM: pfam08527
Aligned: 74 rows
Threshold Bit Score: 172.681
Threshold Setting Gi: 612025126
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4N2M_A       137 IEISLDVDADRDGVVE---KNNPKKASWTWGPEGQGAILLVNCDRETPWLPkE-DCRDEKVYSKEDLKDMSQMILRTKGP 212
XP_003783907 114 VEISLCADTSRTGKGKp-aRAEKDQRTWTWGPGGQGAILLVNCDKDNPKSStM-DCEDDKVFNNKDLQDMSLMTLSTKTP 191 small-eared galago
ELW68577     114 VEISLHADVTRTGKVKp-tRARKDQGTWTWGPRGQGAILLVNCDKDNRKSStM-DCEDDKVLDSKDLQDMSLMTLSVKTP 191 Chinese tree shrew
EGW12398      97 VEISLSTDVTRTGKKKs-aRTKKDQSTWTWGPYGQGAILLVNCDKENPKSSkM-DFEDDKILDNKDLQDMSPMTLSTKTP 174 Chinese hamster
XP_016810498 113 VEISLCADITRTGKVKp-tRAVKDQRTWTWGPCGQGAILLVNCDRDNLESS-AmDCEDDEVLNSEDLQDMSLMTLSTKTP 190 chimpanzee
XP_006914371 113 VEISLSTDITRTSKAKa-tKARKDQRTWTWGPRGQGAILLVNCDKDNLKSSaM-DCLDNKVLDREDLQDMSLVTLSTKTP 190 black flying fox
XP_004741416 113 VEISLSTDITRTGKVKp-iGAKKGQRTWTWGPRGQGAILLVNCDRDHPKSStM-DCKDNDVLDSQDLQDMSPMTLNTNTP 190 domestic ferret
XP_014691662 113 VEITLSADITRTGQVKp-tRATKNQRTWTWGPRGQGAILLVNCDKDNPQSStL-DYEDDEVLDSKELEDMSLVTLSTKTP 190 ass
XP_005318107  98 VEISLQADITRTGKAKqpgRAAKNQRTWTWGPRGQGAILLVNCDRDNPSSS-GmDCEDEEVLDSKDLQDMSLVTLITKTP 176 thirteen-lined ...
1WD9_A       120 VEISLCADITRTGKVKp-tRAVKDQRTWTWGPCGQGAILLVNCDRDNLESSaM-DCEDDEVLDSEDLQDMSLMTLSTKTP 197
4N2M_A       213 DRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVS 292
XP_003783907 192 GDFFTKHQMVLHVDKSVMDKVRVFQATAGKPPSRYKMVLGPRKSSHPLQLKGGQRDTNFYVEGLAFPDADFPGLISLTVS 271 small-eared galago
ELW68577     192 QDFFTRHQLVLHVAKSQMDKVRVFHATRGKSPSRYKMVLGPQQPSHVLELPGGQHSTDFYVEGLVFPDADFPGLVLLTLS 271 Chinese tree shrew
EGW12398     175 KDFFAKYQLVLHVPKAKMSKVRVFRATRGKLPSRYKVVLGPQQFSHCLDLPGGQHSTDFYVEGLAFPDADFQGLIPLTVS 254 Chinese hamster
XP_016810498 191 KDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTIS 270 chimpanzee
XP_006914371 191 RDFFTNHQLVLHVAKSEMDKVRVFQASWGQQLSECKAILGPQRPSHLLELPGGQHSTDFYVEGLAFPDANFSGLISLTVS 270 black flying fox
XP_004741416 191 RDFFTKHRLLLHVSKSEMDKVRVFQASRGKHISRYRVVLGPQQPSHPLELPGGQHSVDFYVEGLAFPDVSFPGLISLTVS 270 domestic ferret
XP_014691662 191 RDFFSTHQLVLHVAKSEMDKVRVFRVHRDKQRSRYKVVLGPQQPSHALELPGGQHSVDFHVEGLAFPDASFSGLVSLTVS 270 ass
XP_005318107 177 KDFSSQHRLVLHVAKSEMDKVRVFQATGCQLPSRFKVVLGPGQPCHLVELPGGQHSRDFYLEGLTFPDASFPGLISLGVS 256 thirteen-lined ...
1WD9_A       198 KDFFTNHTLVLHVARSEMDKVRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTIS 277
4N2M_A       293 LLE 295
XP_003783907 272 LLD 274 small-eared galago
ELW68577     272 LLD 274 Chinese tree shrew
EGW12398     255 LLD 257 Chinese hamster
XP_016810498 271 LLD 273 chimpanzee
XP_006914371 271 LLD 273 black flying fox
XP_004741416 271 LLD 273 domestic ferret
XP_014691662 271 LLg 273 ass
XP_005318107 257 LLD 259 thirteen-lined ground squirrel
1WD9_A       278 LLD 280
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap