4N25,5HP5


Conserved Protein Domain Family
PAD_N

?
pfam08526: PAD_N 
Click on image for an interactive view with Cn3D
Protein-arginine deiminase (PAD) N-terminal domain
This family represents the N-terminal non-catalytic domain of protein-arginine deiminase. This domain has a cupredoxin-like fold.
Statistics
?
PSSM-Id: 400710
View PSSM: pfam08526
Aligned: 49 rows
Threshold Bit Score: 134.22
Threshold Setting Gi: 41056223
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4N25_A        22 MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEaEEVATNGKQRWLLSPSTTLRVT 101 human
XP_001376768   1 MAQKRLIRVSLDQPTYAVCVLGTETVVDLQGCAPASCKFFEISATSGVVIDIFNCHP-VKKSPSGTSKWLLEPGVEVTLK 79  gray short-tail...
EGW12396       1 MASQRAVKLSLKKPTHAVCVVGVETLVDVYSDVPKGANTFGVSGSSEVKIYMVYDPA-RVAEPTGRAHWPLGANVDVVVV 79  Chinese hamster
XP_003989574   1 MAPQRAVQLSLKKPTYAVCVVGVETYVDVHSDVPKGAETFGVSGSPGVEVFVIYDPA-RVTVPTGKTRWPLDANVDVTVS 79  domestic cat
AAI47912       1 MAQRSAVRLSPKKPSYAVCAVGVETHLDVHSDVPEGAENFGVSGSSGVKIFMVYDPA-RVTEPTGRAYWPLDASVEVVIS 79  cattle
5HP5_B        22 MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRT-RVKEPIGKARWPLDTDADMVVS 100 human
XP_003783909   1 MAPQRAVQLSLKSPTHAVCVVGVKTLVDVHSDVPQGAKTFRVSASSGVEVFVVYHTT-RETEPIGKARRPLDAKLDVVVS 79  small-eared galago
XP_003413183   1 MAAQRAVELSLKKPTYAVCVVGVETLVDIHRDVPKGAKTFEVTGSSQVEVFVVYDPA-RVTEPTGKARWPLDTNVDVIVS 79  African savanna...
EHB14745       1 MAPRRAVQLSLKKPTYAVCVVGAEMLVNVHRDVPRDAKTFRVSASSKVEVLMAYDPR-RVTEPTGKAHWPLDANVDVVIS 79  naked mole-rat
XP_016158855   1 MAPRHVVPMSTSRAARGVCVLGTEVFLDTRRSTPRGAASFDVHATPAVTVHVIHS---PATKPSLDSRWPLDPDIEVVVT 77  Collared flycat...
4N25_A       102 MSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLT 135 human
XP_001376768  80 MKAPSSLLNDEKVKISYFTSKSSS--VQALLYLT 111 gray short-tailed opossum
EGW12396      80 ADTVSKDLNDLKVKVSYFGSQEAGALGHSVLYLT 113 Chinese hamster
XP_003989574  80 VDAASKALHDLKVKVSYFGRQEAGALGHSVLYLT 113 domestic cat
AAI47912      80 VDAASKALNDLKVKISYFGQPARGALGHSVLYLT 113 cattle
5HP5_B       101 VGTASKELKDFKVRVSYFGEQEDQALGRSVLYLT 134 human
XP_003783909  80 VDTTSKESKDLKVKVYYFRQPEGDALGHSVLYLT 113 small-eared galago
XP_003413183  80 VDTASKDLNDLKVKVSYFGQHEDSALGHGVLYVT 113 African savanna elephant
EHB14745      80 VDTASKDLNDLKVKVSYFKHQEDDPLGHSMLYLT 113 naked mole-rat
XP_016158855  78 IDVTSRTVDDNQVKISYYDREGRE-LAVAWLYLT 110 Collared flycatcher
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap