1Z3H


Conserved Protein Domain Family
Cse1

?
pfam08506: Cse1 
Click on image for an interactive view with Cn3D
Cse1
This domain is present in Cse1 nuclear export receptor proteins. Cse1 mediates the nuclear export of importin alpha. This domain contains HEAT repeats.
Statistics
?
PSSM-Id: 369909
View PSSM: pfam08506
Aligned: 14 rows
Threshold Bit Score: 544.979
Threshold Setting Gi: 75020809
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1Z3H_B    150 IFKRWRPLFRSDELFLEIKLVLDVFTAPFLNLLKTVDEQITA--NE-NNKASLNILFDVLLVLIKLYYDFNCQDIPEFFE 226  baker's yeast
Q6C6Q8    150 IFKKWRPLFSSDDLNREILLVLNQFTEPYKQLCEEVDRQIEA--NS-NNKAQLDILFRVQFNIFKIFFDLNCQDIPAFFE 226  Yarrowia lipolytica
XP_960866 151 IFARWRPLFSSNALNIEVNHVVNTFGDSFIQMLGVADQQIEA--NK-TNEKALKGWLETMSLLTRIFFDLSCQDLPPIIE 227  Neurospora crassa...
O13671    149 IFKRWRPLFRSDALFLEIKYVLDRFCEPFLALFVQTNNLLRN--GP-QDAESLNSLFQVILLECKLFYDLNCQDIPEFFE 225  Schizosaccharomyc...
Q9ZPY7    162 IFKKFSYEYRTDALFVDLKYCLDNFAAPLTEIFLKTSSLIDSaaSSgGSPPILKPLFESQRLCCTIFYSLNFQDLPEFFE 241  thale cress
OCA21071  156 LFKRYRHEFKSSELWTEIKLVLDTFAAPLTDLFKATIELCNT--HA-NDVNALKVLFSSLILIAKLFHSLNFQDLPEFFE 232  tropical clawed frog
Q7QE09    159 LFKRYRYEFKSQELWEEIKYVLDKMAKPLTDLLQATLGLAEA--HA-GNKEALSVIYNSLVLVCKVFFSLNSQDLPEFFE 235  Anopheles gambiae...
Q9XZU1    159 LFKRYRYEFKSQALWEEIKFVLDRMAKPLTDLLQAKMQLTKV--HE-NNAGALKVIYGSLVLVNKVFFSLNSQDLPEFFE 235  fruit fly
Q6BJX9    152 IFKRWRPLFRSDELFLEIKLVLDKFAEPFLTLLNKLDQLISEalSK-HDKASLNIYFENLLLLIQIYYDLNSQDIPEFFE 230  Debaryomyces hans...
Q5AYN9    150 IFKRWRPLFRSDDLYIEINHVLERFGTPFLTLFQGLDTYLET--NK-SNKDQLTQGFTQLNLMVKLVYDLSCHDLPPMFE 226  Aspergillus nidulans
1Z3H_B    227 DNIQVGMGIFHKYLSYSNPLLEdPDETEHASVLIKVKSSIQELVQLYTTRYEDVFGPMINEFIQITWNLLTS-ISNQPKY 305  baker's yeast
Q6C6Q8    227 DNLDYFMNLLKKYLCYTNPLLEdPDEDDEAGILEKVKASICDAIQLYSLRYEEFFGTYLNGFVETVWNLLTN-TSTQPKY 305  Yarrowia lipolytica
XP_960866 228 TNLQPITMVLHKYLSYANPLFD--DEEDEATPIEILKSDICDALHLFVTKYDDDFGGYVQDFTSNVWNVLSS-VGPQKRY 304  Neurospora crassa...
O13671    226 DHMSEFMTAFLNYFTYTNPSLE--GDEGETNVLIKVKASICEIVELYTLRYEEVF-TMLYDFVNVTWTLLTT-LTPDEKY 301  Schizosaccharomyc...
Q9ZPY7    242 DHMKEWMGEFKKYLSSNYPALE--STEEGLTLVDDLRAAICENINHYIEKNEEEFQGFLNEFASVVWTLLRD-VSKSPSR 318  thale cress
OCA21071  233 DNMETWMTNFHNLLTLDNKLLQ-TDDEEEAGLLETLKSQICDNAALYAQKYDEEFQPYLPRFVTAIWNLLVT-TGQEVKY 310  tropical clawed frog
Q7QE09    236 DNMETWMKAFHGLLTVDVPCLK-TDDDEDAGVLEHLRSQICENLCMYALKYDEEFSPYMPQFVTAVWELLVK-SHIHTKY 313  Anopheles gambiae...
Q9XZU1    236 DNINTWMGAFIQQLAADVPSLR-TADDEDAGVLEHLRAQVCENICLYAKKYDEEFKPFMEQFVTAVWELLVK-TSLHTKY 313  fruit fly
Q6BJX9    231 DHMMNGMEIMHKYLVLETPLLTdQDSDDEIDVLIKTKTSIVELVSLYVSRYADVFEPLIENFITTIWKLINSyVTKQQKF 310  Debaryomyces hans...
Q5AYN9    227 ENMSGLAQILLKYLTYDNQLLH-TDDDAESGQLEYVRAGIFEVLTLYVQKYGDEFQPYIQQFVESSWNFLTT-IGQETKY 304  Aspergillus nidulans
1Z3H_B    306 DILVSKSLSFLTAVTRIPKYFEIFNNESAMNNITEQIILPNVTLREEDVELFEDDPIEYIRRDLEGSDTDTRRRACTDFL 385  baker's yeast
Q6C6Q8    306 DILVSRALTFLTSVAKVPRHTNMFSSPEVLKQLIEKIVVPNMSLRESDEELFEDDPLEYIRRDLEGSDSDTRRRAATDFL 385  Yarrowia lipolytica
XP_960866 305 DVLVSKALHFLTAVASVHRHAQIFNNEEILGTIVEKVILPNVTLRESDIELFEDEPIEFIRRDLEGSDTDSRRKAATDFL 384  Neurospora crassa...
O13671    302 DGLVGKAMAFLTSVIRIRKHAEFFQQDQVLQQFIELVVLPNICLRESDEELFEDDPLEYVRRDLEGSNSDSRARSAIVLV 381  Schizosaccharomyc...
Q9ZPY7    319 DQLATTAIKFLTSVSTSVHHA-LFAGDNVIKEICQSIVIPNVSLRVEDEEIFEMNYIEFIRRDMEGSDVDTRRRIACELL 397  thale cress
OCA21071  311 DLLVSNAIQFLASVCERPHYKNLFEDPSTLTSICEKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLV 390  tropical clawed frog
Q7QE09    314 DALVSNALRFLSTVAERTHYRHLFEDPNVLASICEKVIIPNMDFRVSDEELFEDNPEEYIRRDIEGSDVETRRRAACDLV 393  Anopheles gambiae...
Q9XZU1    314 DSLVSHALQFLSVVADRQHYQSIFENPEILAQICDKVVIPNLDIRPSDEEIFEDSPEEYIRRDIEGSDIDTRRRAACDLV 393  fruit fly
Q6BJX9    311 DLLVVKALSFLTSVTKMAKYQPLFDNETSLKEIIEKIILPNIYFREIDEELFEDEPINFVRSDLEGSDFDSRRKSATDFL 390  Debaryomyces hans...
Q5AYN9    305 DILVSRALKFLTSIAGMPQHAQIFQAESTLAQVIEKVVLPNVSLRESDEELFEDEPIEFIRRDLEGSDSDTRRRAATDFL 384  Aspergillus nidulans
1Z3H_B    386 KELKEKNEVLVTNIFLAHMKGFVDQYMSDPSKNWKFKDLYIYLFTALAINGNITNA-GVSSTNNLLNVVDFFTKEIAPDL 464  baker's yeast
Q6C6Q8    386 RELNDKAESSVTKVALEYVEQFLNLYKQDPASNWKAKDTAIHLYSSIAAKGAVTSS-GVTSINLTVDILSFFSENIAPDL 464  Yarrowia lipolytica
XP_960866 385 RKLLDDFEALVTQVVSKYINHYLEM----GKTDWKAKDTAVYLFLAIAAKGAVTAAqGVKTVNSFVNVIDFFQQHIAADL 460  Neurospora crassa...
O13671    382 RGLLDHFDQKITSVVSTHINANLQQFSTNPSLEWNKKYVALQLFSAIAIKGQSTRL-GVTSINLMVDVVAFFENNIKPDL 460  Schizosaccharomyc...
Q9ZPY7    398 KGLATNYKTQVTEVVSLEIQRLLSSFSANPSANWKDKDCAIYLVVSLSTKKAG----GASVSTDLIDVQNFFANIILPEL 473  thale cress
OCA21071  391 RGLCKFFEGPVTNIFSGYVSSMLQEYAKSPSVNWKHKDAAIYLVTSLASKAQTQKH-GITQANELVNITEFFVNHILPDL 469  tropical clawed frog
Q7QE09    394 KSLLQKFEAKIVEIFGQYLQVLLAKYAENPAANWKAKDTAIYLVTSMASKGQTQKL-GVTQTSELVPLPQFTQQQIIPEL 472  Anopheles gambiae...
Q9XZU1    394 KTLSINFEQKIFGIFGQYLERLLTKYKENPATNWRSKDTAIYLVTSWASRGGTQKH-GITQTSELVPLPEFCAQQIIPEL 472  fruit fly
Q6BJX9    391 RELKEVNTGLLTNTVMTYVNQFLS-----SQSDWKNKDIAIYLFSSLAAKGSVTNV-GVTSTNVLVDVVKFFSDNIANDL 464  Debaryomyces hans...
Q5AYN9    385 KQLNANFEASVTKAVLQYIEHYLNEYGKSPQLNWKAKDTATYLFIAIAAKGVATAThGVTTTNSLISITDFFQKNLAADL 464  Aspergillus nidulans
1Z3H_B    465 Ts-NNIPHIILRVDAIKYIYTFRNQLTKAQLIELMPILATFLQTDEYVVYTYAAITI 520  baker's yeast
Q6C6Q8    465 M--NDSANPILKVDAIKYIYTFRNQLSRDHLIQVFPVLMNHLLSTNYVVCTYSAVTV 519  Yarrowia lipolytica
XP_960866 461 V--ATGGEPIPKVDAIKFLYNFRSQLSKEQWGGAINPLIQNLASPNYVVYTYAATTL 515  Neurospora crassa OR74A
O13671    461 LqpAGVIHPMVLAEDIKYVFTFRNQLNSQQLIDIFPTILRFLEMPSFVVYTYAAIAL 517  Schizosaccharomyces pombe 972h-
Q9ZPY7    474 QsrDVNSFPMLKAGSLKFLTMFRSHIPKPFAMQLFPELVRFLKAESNVVHSYAASCI 530  thale cress
OCA21071  470 KsaNINEYPVLKADGIKYIMFFRSQLPKEQLLVTIPLLIAHLQAESVVVHTYAAHAl 526  tropical clawed frog
Q7QE09    473 EraDVNQLPVLKADALKFIMTFRTILGPQIIVATMPLVSKHLGAASVVVHTYAACAI 529  Anopheles gambiae str. PEST
Q9XZU1    473 ErpNINEFPVLKAAAIKYVMVFRSILGPQVLASCLPQLIRHLPAESSVVHSYAACSV 529  fruit fly
Q6BJX9    465 MntNHSTNPILKTDAIKYIFTFRNQLTKDQLLTTFPLLINHLQDSNTVVYTYSSITI 521  Debaryomyces hansenii
Q5AYN9    465 Vs-GDGVHPILKVDAIKYLYLFRSLITKEQWQEVFPLLVNHLGSSNFVVYTYAAIAV 520  Aspergillus nidulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap