6HV8


Conserved Protein Domain Family
DUF1744

?
pfam08490: DUF1744 
Domain of unknown function (DUF1744)
This domain is found on the epsilon catalytic subunit of DNA polymerase. It is found C terminal to pfam03104 and pfam00136.
Statistics
?
PSSM-Id: 400678
View PSSM: pfam08490
Aligned: 103 rows
Threshold Bit Score: 291.37
Threshold Setting Gi: 124445059
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HV8_A        221 LGQIYKQMFEKkk---gKIETYSYLVDIKEDINFEFVYFTDISKLYRRLSQETTKLKEERGLQFLLLLQSPFi-TKLLGT 296 
Q7Q7P3       1525 VKNLYTSERIAllttsdEHG---EDMLPPSDMTFEVFMEIDAKQVYQRVTRALSAYRDEKRGPTLLCLQTALglHKLNQH 1601 Anopheles gam...
EDS31604     1523 LKNLYTSERLAllkgesENF--TEDSLPPADMTFESFMEIDQKQVYQKLSRLLSAYKDEKRGPTILCVQTALglQKLNQL 1600 southern hous...
Q17H50       1518 LKNLYLAERTAmlstgkSSN----DNLPPEDLTFSIYNEIDINQVYKRLGSTLASYKAEKRGPTILCAQTGFslQKLNQL 1593 yellow fever ...
5_pfamImport    1 LNNMYNSERKLklskteAKE---EHLLPPAGVSFDVKIETDPKQAYRHIVAALQVYRDEKKGPTLIAVQSNRdiQETTML 77  
XP_016843494 1545 MNTLYSTEKIKaiemneIER----VDSIPESMTFHVKVETDVKVIYTQLQNALKNYKNEARGGTILILQTPIatSTLINK 1620 jewel wasp
XP_011154483 1525 LNTLYTQERNAmlaqedESK----ISKLPKTMQFVVQGETNFQQVCRTLQAALTAYKNEGHGATIIINQTAMdkVMLTAE 1600 Jerdon's jump...
XP_026299077 1528 MNTLYTQERDIvismngADK----VKFLPESMQFTLKFETNFQQVCRIIQAAITAYKNEGYSIPIFITQTALdkTALIAQ 1603 honey bee
EFA06672     1501 LNKLYQAERMAk-----KEKGTEDDSLPPASVTFEIRVESDLGQVYKTLQKALQFYKDEKKGPTLLAVQSALepATLRSR 1575 red flour beetle
EFX72310     1517 LVNLYNEERLKklsqadVVE----SSVPARDYSFSIQVETDIRQVYRQMNRLLQTYKDEKRGPTFVAIQSPQdlHATASQ 1592 common water ...
6HV8_A        297 IRLLNQMPIVKLSLN--EVLLPQLNWQPTLLKKLVNHVLSSGSWISHLIKLSQYSNIPICNLRLDSMDYIIDVLYARKLK 374 
Q7Q7P3       1602 LPICLEFPEVSIHIAddAALLSGLDWQRHGARSMIRHFLNLGRVLQMMLEQCLYFQLPLGNMPPDTVLFGADLFFARLLH 1681 Anopheles gam...
EDS31604     1601 IPVCLEFPETQIHIAddASLLSGLEWQRHGARSMVRHFLNLNHVVEMMLDQCRYFQLPIGNMPADTVLFGADLFYARHLL 1680 southern hous...
Q17H50       1594 VPACLDFPETQIHIMddASLLFGLEWQRNGVRTMIRHYLRLNPVIDMMLDQCRYFQIPLGNMPFDTVLFGADLFYARHLQ 1673 yellow fever ...
5_pfamImport   78 LPIINEWPFMSIYVQesEPIYSTLDWQRLGSKLMVKHYLNSEKAIALQAELCRYFHVPIGNIPQDTTMFGADLFFARHLL 157 
XP_016843494 1621 MPYLNEFPLIKAHIQdlDNLYDTLDWQRTGSKMLLRHYFKSEDVLKQLVEQARYFYAPVGNLPPDVVIFGADLFYARHLQ 1700 jewel wasp
XP_011154483 1601 MPLLNDFPIVSTHVQdvENLYNMLEWQKIGAKMMVRHYLKSQQIIELMAEQCRFFHAPIGNIPADPTLFGADLFYARHLH 1680 Jerdon's jump...
XP_026299077 1604 MPLLNDFPLISTHVQdiENLYNTLEWQKVGAKIMIRHYFKSQQILELMSEQCRFFHAPIGNIPADPVIFGADLFFARHLQ 1683 honey bee
EFA06672     1576 IPLFSDFPQVQIHITdeEELYNVMDWQKIGGRALVRHYLNSEKVLDLMIEQSRYFHLPVGNMPPDPALFGSDLFYARHLT 1655 red flour beetle
EFX72310     1593 IQTLNEFPLVPIHSTdpDGLYNVLDWQRVGSKVCLRHFLRLRTVLDANLEQCRYFHIPIGNLPSDANLFGADLFFARHLI 1672 common water ...
6HV8_A        375 KENIVLWWNEkAPLPDHGGIQNDFD---LNTswimndSEFPKINNSGVYDNVVLDVGVDNLTVNTILTSALINDAEGSDL 451 
Q7Q7P3       1682 RHNFVLWFSG-GARPDLGGREADDSrllAEFe----dNISVVQNRSGFYRSVCVELTVESLAVSALLQASKVQELEGTSS 1756 Anopheles gam...
EDS31604     1681 KSNFILWWSP-SSRPDLGGREADDSrllAEFe----dNISVVQNRSGFYGTVCVELSIESLAVSALLQAGKVQEMEGASS 1755 southern hous...
Q17H50       1674 KHNFVLWCSP-NSRPDLGGREADDSrllAEFe----dNISVVQNRQGFYGDVCVELTIDSLAVSALLQASRVQEMEGAAS 1748 yellow fever ...
5_pfamImport  158 KNNFVLWCSE-SDRPDLGGREADDNrllSDFe----eNTNVISNNLGCYSTICVELDIDSLAVNTLLQSHHVHDIEGTSS 232 
XP_016843494 1701 KANFVLWWSP-TEKPDFGGSENDDSrllTDFe----eSSGCLKNNPGVYSNVCFELDVISLAVTALVQANHINDIDGTSS 1775 jewel wasp
XP_011154483 1681 RNNFVLWCSP-TEKPDLGGSENDDNrllTDFe----eSSSCAANNPGTYSSVCVQLDVESLAVNALLQYHHIHDIDGTST 1755 Jerdon's jump...
XP_026299077 1684 KNNFVLWCSP-TEKPDLGGSEHDDNrllTDFe----eSSQCAANNFGTYSSVCIELEIENLAVNTLLQYHHIHDIDGTSN 1758 honey bee
EFA06672     1656 KHNHVLWCSP-TDKPDLGGVEENDS----RLlaenqeGSSEVCNVPGWYSSVCIELDVDCLAINTLLQSHHVTDIEGTSS 1730 red flour beetle
EFX72310     1673 RNNCILWCSP-TERPDLGGKEADDNrlvTEIed---aTTTLVVNNPGVYTNVCVEMDVDALAVTTLLQSHQVLDVEGTSS 1748 common water ...
6HV8_A        452 ----------VNNNMGIDDkDAViNSPSEFVHDAFSNDALNVLRGMLKEWWDEAL-KENSTADLLVNSLASWVQNPNAKL 520 
Q7Q7P3       1757 aitfdvmpqaSLEEMITSG-PNG-QQLSNYDETALCSQAFRVMRMMVNTWLREVSiNRNVFSDFQIIHFYRWVRSSRALL 1834 Anopheles gam...
EDS31604     1756 aitfdvipqaSLDDMISNQ-GGV-QTLPSYDETALCSQAFRVMRSMVNGWLREVSiNRNIFSDFQIIHFYRWVRSSKALL 1833 southern hous...
Q17H50       1749 aitfdvipqaSLDDMIANQ---G-QTLPSYDETALCSQAFRVMRSMVNGWLRDVSlNKNAFADFQIIHFYRWVRSSRALL 1824 yellow fever ...
5_pfamImport  233 svgfdtmpqlSIGEQVSGQ---V-PVLPIYDEGALCSGAFKVMRFMVNAWLRDVTiHRNVFADFQIVHFYRWLRSPTALL 308 
XP_016843494 1776 yvafhnaqqtSLQDMVTND-GSA-PSIPSYDETALCGPAFRILRLMVATWLKEVSnFKNPFADFLLIHFYRWLRSPTSFL 1853 jewel wasp
XP_011154483 1756 fvafhnqqrpSVQDIVTGD--AA-TIIPSYDEITLCNPAFKTLRSMVNAWLLEVSvYKNVFADYQLIHFYRWLRSSNALL 1832 Jerdon's jump...
XP_026299077 1759 fvafhnqqqtSVQDMAMGD-SMT-NTIPSYDEIVLCSPAFRSLRSMVNAWLLDVSvYKNVFADYQIIHFYRWLRSPNALL 1836 honey bee
EFA06672     1731 ataf---dgvGATSLDDLV---G-DNPTVYDETARCAEAFKILRTMASIWMRDISlYQNIFADFQVVHFYRWLRAPKALL 1803 red flour beetle
EFX72310     1749 stafd-vpqvSLKDMLNDN--HT-AELSSYSESAMCVTVFRVLKSVVASWLRDISvHRNVFADFQVIHFYRWLRSPTALL 1824 common water ...
6HV8_A        521 FDGLLRYHVHNLTKKALLQLVNEFSALGSTIVYADRNQILIKTNKYSPENCYAYSQYMMKAVRTNPMFSYLDLNIKRYWD 600 
Q7Q7P3       1835 YDPALRRALNTIMRKLFLQIVAEFRRMKATIIYADFNRIVIDTGKRTVGDAISYTDYIVQNIRNRELFHSVSLSFQQAWE 1914 Anopheles gam...
EDS31604     1834 YDPALRRALNTLMRKLFLQIIAEFQRLKAEIIYADFNRIVINTGKKAVMDAIAYTDYVVQSIRNKELFHSVSLSYQQSWE 1913 southern hous...
Q17H50       1825 YDPAIRRALNTLMRKLFLQMISEFQRLKAEIIYADFNRIVINTGKKTVSDAIAYTDYVVQSIRNKELFHSISISYRRAWE 1904 yellow fever ...
5_pfamImport  309 YDPALRRTLHNLMKKLFMQLVAEFKRLGSVIVYANFNKIIVCTKKRNIEDAIGYIEFVVASIKNKELFHSIQMSYSQCWK 388 
XP_016843494 1854 YDPALRRTLHNYSKKLFVQLVSELQRLGATIIFADFTKIILCTKKRVTEDAYGYTQFIIQSILNKEIFHSIHFDVRNCWE 1933 jewel wasp
XP_011154483 1833 YDPALRRTLHTYMKKLYIQLIAEFKTLGCIVVFANFNKIIMCTRKRSVTDALSYMEFVVQTIRNKELFHSIEITFDQCWE 1912 Jerdon's jump...
XP_026299077 1837 YDPALRRTLHTYMKKLFVQLLAEFKTLGSIIVFANFNKIIVCTKKRAVNDALGYIEFVVQTIRNKEIFHSIEITFEQCWE 1916 honey bee
EFA06672     1804 YDPALLRTLQNLMKKLFLQLVAEFKRLGCTIIYANFNKIVICSKKKSVEDAMENVEFVVTSIRNKELFHSLDISFRQCWE 1883 red flour beetle
EFX72310     1825 YDPALRRMLQNLMRKYFVQLLAEFQRLGATVVYADFGRIVLGTKKRRIPDALSYVSFVCASLHQKELFRSLELNVQHCWQ 1904 common water ...
6HV8_A        601 LLIWMDKFNFSGL 613 
Q7Q7P3       1915 FLLWNDPTNYGGV 1927 Anopheles gambiae str. PEST
EDS31604     1914 FLLWIDSSNFGGI 1926 southern house mosquito
Q17H50       1905 FLLWIDAANYSGI 1917 yellow fever mosquito
5_pfamImport  389 YLMWLDPANHGGV 401 
XP_016843494 1934 YLIWLDLSNHAGV 1946 jewel wasp
XP_011154483 1913 YLVWLDLHNHAGI 1925 Jerdon's jumping ant
XP_026299077 1917 YLKWLDIHNYAGI 1929 honey bee
EFA06672     1884 TLVWLDPANYAGV 1896 red flour beetle
EFX72310     1905 LLVWLDPANYGGV 1917 common water flea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap