Conserved Protein Domain Family
VGCC_alpha2

?
pfam08473: VGCC_alpha2 
Neuronal voltage-dependent calcium channel alpha 2acd
This eukaryotic domain has been found in the neuronal voltage-dependent calcium channel (VGCC) alpha 2a, 2c, and 2d subunits. It is also found in other calcium channel alpha-2 delta subunits to the C-terminus of a Cache domain (pfam02743).
Statistics
?
PSSM-Id: 400667
View PSSM: pfam08473
Aligned: 15 rows
Threshold Bit Score: 658.701
Threshold Setting Gi: 0
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_023180764   638 FESLLPNSFESEGHVFIAPREYCNDLEL---SNNNTEFLLNFIALMEKVTPDSKQCDSLLLHNLILDTGIIRQLVDKVWK 714  southern pla...
10_pfamImport    2 FESLLPNNFELEGRVFLAPRQYCKELEQ---SDNNTEFLENFISLMEKVTPDSKHCDSFLLHNLILDTGITRDLADRVWK 78  
XP_014326828   635 SESLLSDKFDEYGYTFIAPRMYCKDLKPpdkETNNTEYLMDFNNYIDTKTPNNPMCNVELVNRLLLDAGITSDLIK-IWK 713  southern pla...
XP_023808266   627 SETLLVDKFDEYGYTFIAPRTYCKDMEPl-nKYTNTEFLVMFNDYIDRRTPNDPECNVELMNRLLLDAGITADLIK-IWK 704  Japanese medaka
XP_019202616   629 SESLMADKFDEYGYTLIAPRDYCKDLKP---DANNTEFLKRFNDYIDRKTPNNPMCNVDLVNRLLLDAGITSDLIK-IWK 704  Nile tilapia
XP_028425876   619 SESLMADKFDEYGYTFIAPRMYCKDLKPpdkNKNNTEFLIEFNNYIDTKTPNNPMCNVELVNRLLLDAGITSSLIK-YWK 697  yellow perch
XP_014341948   638 FESLLPNSFESDGHVFIAPREYCKDLDL---SNNNTEFLENFIALMEKVTPDSKQCNNFLLHNLILDTGITRQLAERVWK 714  coelacanth
XP_023476141   666 FEFLLPSSFESEGHVFIAPREYCKDLNA---SDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGITQQLVERVWR 742  horse
XP_003454634   630 MQSLLPSSFESSGHVFLAPREYCKRLQL---SDNNTQFLQNFLSLMLDLSPESDECDHGLIHNLIFDSRIIGQLASRVWK 706  Nile tilapia
XP_015207700   651 SESMQLENFNENGYTLIAPREYCKDLKP---SENRTQFLMDFNEFIDRKTPNNPTCNAMLVNRLLLDAGITSELVQ-HWK 726  spotted gar
XP_023180764   715 NKDLNTygflavfaaTDGGITRvfpnkaaET------WE--EDPEPFNASYYRRSLDnkgyIFTAPyrsAGADLLNP--- 783  southern pla...
10_pfamImport   79 DKDLLT---------LEADIDR-------ET------WStkETQNDWASKVKCVSIG----LFTSI---AGYRPSEL--- 126 
XP_014326828   714 RNELQQgvia-rfvaTDGGITRvfpksagLD------WK--EDAETYESSFYKRSLDndvyIFTPT---------RC--- 772  southern pla...
XP_023808266   705 KSELPNgvka-vfvaTDGGITRvypesagME------WN--EEVETYESSFYKRSLEndlyIFTPKpynKNLSSSES--- 772  Japanese medaka
XP_019202616   705 ENDPINgvms-ryvaTEGGITRvyptsngLD------WT--GQAETYDLSFYKRSLDndlyIFTPTvfqNS----SQ--- 768  Nile tilapia
XP_028425876   698 GTELQHgvla-rfvaTDGGITRvypksagLY------WK--EEAETYESSFYKRSLDndlyVFTP-----------Tpyl 757  yellow perch
XP_014341948   715 DRDLHTygllavfaaTDGGITRvfpnkseKQqsshkrIVvlRAPHPAVAGsa-------grALALGskaNNYAPFDA--- 784  coelacanth
XP_023476141   743 DQDLNTysllavfaaTDGGITRifpnkaaED------WT--ENPEPFNASFYRRSLDnhgyVFKPPhqdALLRPLEL--- 811  horse
XP_003454634   707 NKDLNSygflavfasTDGGITRvfpniaaEL------WD--EDPEPFNSNFYRRSLDnkgyMFRSTlrsSLDDPIGA--- 775  Nile tilapia
XP_015207700   727 KQSLtgvva--rfvaTDGGITRvypksagED------WK--ESAETYEASFYKRSLDndfyIFTAPyfnNSGSGESG--- 793  spotted gar
XP_023180764   784 -----ENDtvGILVSTALDITIGGK---TVKPAVLGVKLDLEAWTDKFki-lASNHTDSRQGSN--TCGpnrgcemdCEA 852  southern pla...
10_pfamImport  127 -----ENNtvGILVSTAVELDIMGK---KLKPAVVGVKLDLESWVEKFkvlaSNQSERHPQGPRflQCSpsascemdCDV 198 
XP_014326828   773 -----TESdnDVLVSRAVNLEINNI---TLKPAVVGVKLDIDSWMESF----INITYRMNCKDE--ICG--------CKK 830  southern pla...
XP_023808266   773 -----DES---ILASKAVDLKIGEV---LLKPAVVGVKLDIKAWMNSL----MNTTTTINCKDE--ICG--------CRI 827  Japanese medaka
XP_019202616   769 -----YEG--SVLVSKAVNLKIDDI---TLKPAVAGVQLDIDMWREIF----SNTSQRKSCKDE--LCG--------CTI 824  Nile tilapia
XP_028425876   758 tkentSDD--SVLVSKAVNLNIDGIilkP--A-VVGVKLDISAWMASF----INITQKINCNDE--ICG--------CQR 818  yellow perch
XP_014341948   785 -----MNDtiGILVSTVVELNMNGK---TLKPAVVGVKLDLEAWVSKFkilaSNQT--DPSGPQ--KCEpsascemdCDA 852  coelacanth
XP_023476141   812 -----ENDtvGILVSTAVELSLGGR---TLRPAVVGVKLDLEAWAEKFk--vLASNRTHQDQPQ--KCGpsshcemdCEV 879  horse
XP_003454634   776 -----ENGtsEIVVSSAVEVNIAGK---LLRPAVVGGKLDLEAWVDKFkilaSNMsdsr---qgshKCGplrscemdCEM 844  Nile tilapia
XP_015207700   794 -----FDS--GILVSRAVDLTIDGK---KMKPAVVGVKISIAEWMANF----TNATIRKGCNSE--ICG--------CEK 849  spotted gar
XP_023180764   853 NSDDLLCYLIDDGGFLIMSNQKDDWSEVGKFLGVVDPNLMYAlYNNSFYKRkqsFDYqsvCELLQNSDTGAARRGVFVPT 932  southern pla...
10_pfamImport  199 NDEELLCVLIDDGGFLVMSNQQDHWSQVSQPFDQGASSLAIG-FNGQIFLL---YIY---CIYVPREASSLGATGVIKPT 271 
XP_014326828   831 GDQYIDCVVLDDGGFMVMSNQEDYVNQIGCFFGIIDPDLMRTlVNSSLFTAkstYDYqslCEPKRESKAAAGLRSIYVPT 910  southern pla...
XP_023808266   828 NNAYIDCIVLDDGGFLVMSNQEEYIKEIGNFFGVIDPTIMRAlVNDSLYTSkstYDYqslCDPKRTSKKAAGPRSVYVPT 907  Japanese medaka
XP_019202616   825 GDKNLNCYILDDGGFLVMTNQIDHFNEIGKFFGEIDPCIMRSlINSSLYTNkstYNYqslCDPKKEDKTSAGMRSVYVPT 904  Nile tilapia
XP_028425876   819 NDVYVDCVILDDGGFLVMSNRDEYIDQIGRFFGGIDPILMVNlVNSSLFTSkktFDYqslCDPEKESKAAAGLRSVYVPT 898  yellow perch
XP_014341948   853 YNNDLLCVLIDDGGFLIMSNQREHWNQIGMFFSEVDANLMHAlYNYSFFRKkesFDYqsvCTPKAESNTGAAPRGVFVPT 932  coelacanth
XP_023476141   880 NNEDLLCILIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMMAlYNNSFYTRkesYDYqaaCAPQPQGNLGAAPRGVFVPT 959  horse
XP_003454634   845 DTNELGCYLIDDGGFLVMSNQADHFQKIGVFFGDVDAPLMYAlYNNSIFTRrqsFQYqsaCEPVSSSHTGAAPRGVFVPS 924  Nile tilapia
XP_015207700   850 NSKLVDCVILDDGGFLLMSNQDEYIDEIGWFFGEIDPILMTNlVNTSLYAFnksYDYqsvCDPDRGPKAAAGLRSVFVPT 929  spotted gar
XP_023180764   933 IADFVNLAWWTSAAAWSLFQQLLYGLAYHSWFVTDEVEAEVI-E-SKERSCVMIQTQYYFSNLSNSYNILQDCGNCSRLI 1010 southern pla...
10_pfamImport  272 IADVLNLAWLTSAAAWSLFQHLLVSVIYGSWLQADDIAAENM-E-PREASCIMKQTQYYFGNINSTYSAVIDCGPCSRYF 349 
XP_014326828   911 IADILNLGWWATAAAWSIVQQLLVSITLPNVLDAAETDDQ-VsDaMSKEVCITEQTQYFFENDETSFGGLFECANSTRQY 989  southern pla...
XP_023808266   908 IADILNLGWWATAAAWSVLQQLMVSITYPSFLDAVDVEDK-MpDsMTKEVCITEQTQYYFENKRSTFSGSVDCGNCSRLF 986  Japanese medaka
XP_019202616   905 IADVLNLGWWATAAAWSIMQQLVVSITLPNFGEAAT--DD-ApD-VEKEVCIKEEYQYYFENDSLSFRGVIDTEKCSRLY 980  Nile tilapia
XP_028425876   899 IADILNLGWFATAAAWSILQQLLVSITFPNFLDAAEMDDE-MsDaMLKEVCITEQTQYYFENNDRSFRGTIDCENCTRLY 977  yellow perch
XP_014341948   933 IFDFLNLAWWTSAAAWSLLQQLMYGLAYNSWFRADDVTADGL-D-LRETSCIMKETQYFFSNTATSFNNMIDCGNCSRLF 1010 coelacanth
XP_023476141   960 VADFLNLAWWTSAAAWSLFQQLLYGLISHSWFQADPAEAESNpE-ARESSCVMKQTQYYFGSVNASYNAIIDCGNCSRLF 1038 horse
XP_003454634   925 IADVLSLAWWTSTMAWSVFQQLLYGLAYNSWLYQADVLIEGF-E-TKESSCVTIQSQFYFTNTTNSYNMLQDCGNCSRLF 1002 Nile tilapia
XP_015207700   930 IADILNIGWWASAAAWSIVQQLFVSFTFPNFLEAADTEEE-QtAaLSKESCITEQTQYYFDNNNKSFSGVLDCENCSRIY 1008 spotted gar
XP_023180764  1011 HAKRINNTNLLFVVAE-KLPCS-SCEIEDlS------QDKE-E-FKeENPCEEMTTARYRKGPSTCFDSNAAENTSDCG 1079 southern plat...
10_pfamImport  350 HAQRLSNTNLLFVVAE-KMICS-QCDSMKlD------QAETrCiPEgPEQCDLVQMPRYRKGPHMCFDYNPMEDTSDCG 420 
XP_014326828   990 LAEKVPNTNLVLIISDrQQGNSqSCGLGPlV------QDEK-Q-SAgPDPCEMALSPRYRKGPIVCFDKTEHEEDPDCG 1060 southern plat...
XP_023808266   987 LAEKLPKTNLVFIIADaKGTCS-SCVSSKlI------QEEQ-Q-SDgPNPCEMALSPRYRKGP-ACFDKNQPEKDADCG 1055 Japanese medaka
XP_019202616   981 HAERLPKTNLVFIVAEtEHGC--ECQEKIlK------QEEQ-E-SQgPDPCQLASEPRFRKGPAACFDNNSHEDNADCG 1049 Nile tilapia
XP_028425876   978 HAEKLPKTNLVFIIADaKLTCS-SCdtkpli--------qdeqqSNgPDPCEMAQNPRYRKGPAVCFDNNEHEKDPDCG 1047 yellow perch
XP_014341948  1011 HAQRLANTNLLFVVAD-KLMCN-QCDSMKlI------QAKTr--SDgPPQCDLVENPRYRKGPDLCFDYNALEDTTDCG 1079 coelacanth
XP_023476141  1039 HAQRLTNTNLLFVVAE-KPLCS-QCEAGRlL------QKET-H-SDgPEQCELVQRPRYRRGPHICFDYNATEDTSDCG 1107 horse
XP_003454634  1003 HAKRIENTNLLFVVAE-KLLCQ-SCEIETlTqvrtefQEEN--------PCEVLNNTRYRKGPTSCFDYSALENTSECG 1071 Nile tilapia
XP_015207700  1009 RAEKLPNTNLLFLIVDaKETCP-CSSTKPlI------QAEQ-P-SKgPDPCDLVHNPRYRKGPEVCFDNDENEDYTDCG 1078 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap