3V0A


Conserved Protein Domain Family
NTNH_C

?
pfam08470: NTNH_C 
Nontoxic nonhaemagglutinin C-terminal
Bacteria of the Clostridium genus produce protein neurotoxins, which are complexes consisting of neurotoxin (NT), haemagglutinin (HA), nontoxic nonhaemagglutinin (NTNH), and RNA. The domain described here is found at the C-terminus of the NTNH component.
Statistics
?
PSSM-Id: 400665
View PSSM: pfam08470
Aligned: 2 rows
Threshold Bit Score: 300.079
Threshold Setting Gi: 152931876
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3V0A_B        1034 NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDE 1113
tigr:CLC_0861 1032 NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDE 1111 Clostridium ...
3V0A_B        1114 VIISVLDNMEKYIDISEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNNDMSKYLYLWS 1193
tigr:CLC_0861 1112 VIISVLDNMEKYIDISEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNNDMSKYLYLWS 1191 Clostridium ...
3V0A_B        1194 FK 1195
tigr:CLC_0861 1192 FK 1193 Clostridium botulinum A str. Hall
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap