Conserved Protein Domain Family
Gemini_AC4_5_2

?
pfam08464: Gemini_AC4_5_2 
Geminivirus AC4/5 conserved region
This domain is found in replication initiator (Rep) associated proteins such as AC5 in the Geminivirus/Begomovirus.
Statistics
?
PSSM-Id: 369889
View PSSM: pfam08464
Aligned: 17 rows
Threshold Bit Score: 65.865
Threshold Setting Gi: 123881498
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q80IL9     1 MTNIVFLLKRLDLTRAFTTLRNIRASVHSVHPGLPIHGPLSPC 43  Eupatorium yellow vein virus - [Yamaguchi]
A0FK15   138 VRDVMTLLVRLDLTRTFTPSRNIWTSPDAIDPGLPVHGPVNPS 180 Soybean blistering mosaic virus
Q913X8   129 MRHVMTLFKRLNLTGTFTTFRNIRRSVHTINAGLPVHWAINPS 171 Pepper huasteco yellow vein virus-[Sinaloa]
Q9WPG3    19 MSNVVLRIERLDLTWALTSLRDIRASIHSVDPGLSVCRSVLPY 61  Tomato yellow leaf curl Thailand virus-[2]
Q08591    99 MDHIVSRLERLDLTWAFTALRNIWASIHPIPPGLPIDGSVCPG 141 Indian cassava mosaic virus
Q9E004   138 MGDIVTLFKRLDFTWAFTTPWNIGGSIHPIYLGLPVHGPVYPV 180 Tomato rugose mosaic virus-[Ube]
ABO40823  88 MRHIVPRFKRLHLTRTFTSPWHVGASVHSIHSGLSVHRPVCPR 130 Tomato leaf curl New Delhi virus 5
Q7T491    99 MRDIVPRFKRLNFTRTFTAPWHVGTSIHPVHLWFSVHRPVCPG 141 Squash leaf curl China virus - [K]
ABL09102  88 MRDIVPRFKGLHLTRAFTAPWHVGTTIHSVHSGFSVHRPVGPG 130 Tomato leaf curl New Delhi virus - [Potato]
ABP96797   1 MGYVVPLFIRLYLTWAFTTFGHIRGSVHSVQSGLAVHGPVGPC 43  Ageratum yellow vein virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap