Conserved Protein Domain Family
Sfi1

?
pfam08457: Sfi1 
Sfi1 spindle body protein
This is a family of fungal spindle pole body proteins that play a role in spindle body duplication. They contain binding sites for calmodulin-like proteins called centrins which are present in microtubule-organising centers.
Statistics
?
PSSM-Id: 400658
View PSSM: pfam08457
Aligned: 32 rows
Threshold Bit Score: 473.704
Threshold Setting Gi: 449304490
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EED21482           355 ELEKKRQNSRTKRFFRHLENRAAKARDLYLMTKAFSHWAQLTSDELSKASAAREHILSIKYFNAWREIT-------AVNV 427  Talaromy...
O13652             203 MLKYFPRWVQKLRNIQSRIYSAGEAYRLILIGQMVNRWRQKTRERLHQKLRFQKNAFLLDVLLKWSALT-------VNWN 275  Schizosa...
EAA26776           513 ERERHEAEAEYEAWVDRMERRATRVYEVFTIQNMLNFWQDQAREELDRTAVARRHLVRKRAFDAWRAQH-------IQDE 585  Neurospo...
XP_006691266      1500 fARDARKRREHKEWVDKMERRANRVYEICTARDALARWQAAAKQERDRTAVARRHLVRKRAFEGWRDEH-------IRVE 1572 Chaetomi...
XP_003657393       284 qrlkAEAAAQYEAYVAKMERRATRVYEIFTIRTLLDHWQDQAREEIDRTAVARRHLVRKRAFEGWHAQH-------VEDE 356  Thermoth...
jgi:MYCTH_2130496  308 lrlEAERAAEHEAYVERMERRATRVYEIFTIHTVLAEWQERAQEELDRTAVARRHLVRKRTFEGWHAQH-------IKDQ 380  Thermoth...
Q2GUV2             292 LRIKAEEAAKYEAYVAKMEKRASRVYEIITIHNVFAEWQGRAREERERTAVARRHLVRKRTFEGWHAQH-------VEDE 364  Chaetomi...
EJT72042           532 KAESARREAENARLHERMMRRAARAADLSLLHKAFTHWRAAASHEAERTEIARRHLLRKKVFVAWSEKV-------SADR 604  Gaeumann...
XP_003716757       621 aaETARQLVETARREERIMKRAERAYELSLLHKAFTHWWTAAHEEVERTEIARRHLLRKKVFDGWSQKV-------SADK 693  Pyricula...
XP_001585650       408 HLEAQQKLREIEERFVKLERRVDRARDRHLKHKAFTHWAAITREKVEITKVAQRQILRSRMFTAWKTQTeetekknKENE 487  Scleroti...
EED21482           428 MKAERFAIQKPLDGWRRKIQQIRTLDDHAIHAHEYNRKRKYLMMLLWNFyYEHRAPEWSDFRLMKGAFLSWIRALRRQRE 507  Talaromy...
O13652             276 RKHEYMLKRRVFTNWMSKRRRNESLIQKANVFFQHSVLAHSFKTWKANL-SIKNAATLYEKKVVFMSFNRWHANYESHVL 354  Schizosa...
EAA26776           586 TKARNFVLIHALQRWTAVALHQEVRRHVAEQTEERETMREGLMHWYRLQ-KGRVADDYAVFKAMKGSLTHWTSRTKDVQD 664  Neurospo...
XP_006691266      1573 NKVRKFQADHYLKKWGEAALENEVRKEVADQWRCRRLLKNSVNFMLKET-KERQADNVYANSLAKDALATWSEKARELQE 1651 Chaetomi...
XP_003657393       357 TKVQNFILKNALQTWTQVALHHEVRHEVAAHWHQQQLRKQTLHTMLEET-KERQADEFYAVNLAKQCLGTWAEKARDLND 435  Thermoth...
jgi:MYCTH_2130496  381 TKVKNFILNNVLQKWSQVALHHEVRREVAVQWHQQELCKRSFHTLWQET-KERAADEFYAVGLASHCLSIWVNKACEIQD 459  Thermoth...
Q2GUV2             365 TKVRNFILSNVLQKWSQVALHHEVRHEVAAQWHQQDLCKQSLHTMWEES-KRRLADEFYAFGLAGQCLDAWTDKARDTRD 443  Chaetomi...
EJT72042           605 TKVKAFAATGLLGAWSNALEQHREVKRFSAQMYPADLAKRCFTKWRREY-QSCAAELWYSVRLAEDCVHKWKHETSLCRG 683  Gaeumann...
XP_003716757       694 YKAFNFAASGALLAWRTATKKQEEQEEVALQMRSRGLVKIAFAKLFRRH-QECVADAFNSTRLGQWAILTWSLELQSAAK 772  Pyricula...
XP_001585650       488 EKARKFQLRKFFGKLKAKKEEIDEKLNMASQVAKGNLLGRVFSKLAQEK-KVVEFTQRIDEKNKQRALSTWVEKTQAVSE 566  Scleroti...
EED21482           508 REAEIDHGLRQELLHATLKTWSYRLRSVEAAQLDADMGYRKKLLGDQMEVWRAQTRLQPAAIQIATKIDSRVLKTTLIQW 587  Talaromy...
O13652             355 DLQKAELFSQKAYYSIALHKWKLRIEELSDLMNKADDLYEVNLLQRMLVLWRRKATTYEKIDFWMDGHDVDIVKSAFFKW 434  Schizosa...
EAA26776           665 DHEVAIALDERLLLDEAVNIWQEEAEDLRYTGYKCRGYKVTRDCQIILADWHEQSRLLRTLRKFRAADERTLKWNCLEHW 744  Neurospo...
XP_006691266      1652 EGEVAAAVDKHVLLDEAVGIWREEADDQQVRARLGQRLLQLKQLKRGMDRWREKATLVRRLIELEQKRAAETKQEVLDTW 1731 Chaetomi...
XP_003657393       436 EYQVAVALDERLLLDEAVNIWHEELEVQQYDAYECTRQFLILGCRRDLEYWQEQARLSALLKQYRTKDEQDAKRQALDVW 515  Thermoth...
jgi:MYCTH_2130496  460 EYQVAVALDERLVLDEAVNIWLEEVDIQQYNAYECTRQWLVQGCRRDLDYWQEQARLSALLKQHNAKEEQALKRRVLEAL 539  Thermoth...
Q2GUV2             444 EYQVAVALDERLVLDEVVNIWLEEVDAQQYNAYEYTRQWLVLGCRRDLDYWQEQARLSALLRQYTGKQERDTIVRTLETW 523  Chaetomi...
EJT72042           684 LHAAAEADAVHSLRASSIGAWRSMSAETKASTVEASDRLEKRQLSGLLSTWHTQAMLESRLRRALVSREERIKTESLHVW 763  Gaeumann...
XP_003716757       773 LWTAAEADASHMRQSNALSMWQSRRSDMFMFQSMASSLVLDHDAAAIFEFWRKQAKLESRFREFSNSQRKNMQAITLSTL 852  Pyricula...
XP_001585650       567 ATQLAEDERLLNVVTKTMDSWKEKTETQVVLNARAERAAKAKQLGSAFKKWRLEAQTAPAEKKVVASHNASLLKISLSIW 646  Scleroti...
EED21482           588 RLRTESVQHAKEADRLRVLRNTWTTWNDHLRCYALKERIDERLKKEAIYRWILAERYRLAQRIRDQRIQREAFAQFIFTV 667  Talaromy...
O13652             435 KNKFIKVDRNFELADTILQNTFLTKWRLAVRVKVVQEKRNKDRLIVTFRFWYYLMKAKSFQHKRDHRLLTIAWEAWKDNY 514  Schizosa...
EAA26776           745 QEEAEYARRDGLLADAVLLLNPVDTWKLELKLKLWNIREDEETLEDTLTHWFLEQRLALFQHHAASTTKKSTLSTWLDAT 824  Neurospo...
XP_006691266      1732 KEVSKGQKTQAEKADAFAAKEHVEHWDREMKLKLWRERDEHETKIAVVERWSNEEKLAWLKRRHDTQNKKNVLNTMLLAA 1811 Chaetomi...
XP_003657393       516 HSAFQNAKSEAGIADAFFLEDPVDHWEREMKLKLFIERDEYETKAAVLNRWALEEKLAWYQRYSETRVKREALDTFVAAA 595  Thermoth...
jgi:MYCTH_2130496  540 SIALRKVKRDTAVADAFLLTEPVDHWEREMRLKLFLERDELEMKAAVLEHWALEEKLAWYKGHLETRNKRQTLNTLFAAA 619  Thermoth...
Q2GUV2             524 NSISQDAKGEAAVADAFLLNEPLGHWEREMKLKLFIERDEFETKAATLEHWALEEKLTWYQGHLETRTKRQTLEAFFAAF 603  Chaetomi...
EJT72042           764 KLNLQAAGTQKQAAQRRSIQGFARHWVLELELKLFRENVDSLTLLSSTYQWVLESRSKLVRRFNRKSTQNSALLNLRAEY 843  Gaeumann...
XP_003716757       853 VHASDLLQMLGTKADTMMLKDFAQHWLRELRLRDVSRRRDHDLLYNQLYEWLMEERYALFYRYSEYNRTAAALSDLRAIH 932  Pyricula...
XP_001585650       647 KLRTEQEKQATAIDHDKIKREAFTEWRHQTRLKRLRAISDDRAVAKASKTWRLETKCAVLQKEKKEETKSACLEVWFDRS 726  Scleroti...
EED21482           668 RDTSKELLQRENQYFRHYNEDLARSALDCWRNKLAVQRQREYAAMEFYVPRIEQEALTIWNSRHQHLQNLDKW----SRD 743  Talaromy...
O13652             515 QR-RIKLQKEAQELQLTRIQKIAKQYLIKWRISLLDIKELSIRAEKLHTTNEIIGVWNQWVVSYNRKVGM-------QQN 586  Schizosa...
EAA26776           825 QTSLSVCQRPESEADHFYSDHLLSSCFSTWFDASNAIFTPRHNANLICLYRTTKPCLDRWREALVSSTTRNAYyarkASK 904  Neurospo...
XP_006691266      1812 RKAQDERLRQEDDADALNEYYTQAGALNTWKKAHEKADIGRQNANLVNLYRTGKPAVDYWRERFRETSARGAYckrvADK 1891 Chaetomi...
XP_003657393       596 RRARTDRERHEQEAAYVDSFYTRAEAVDTWAAETDKMWKHYHNADLVNLYRTTRPCMDHWREQCHQSRARDSYyrrkADR 675  Thermoth...
jgi:MYCTH_2130496  620 RQARGERERHEEEADYVDAYYTQTEVLDTWIEGTDQMWKHRQNANLVNLYRTTRPCIDHWRERCQQSQARDGFywkrAEK 699  Thermoth...
Q2GUV2             604 TQARGERERHEQEADYVDTYYTQTEVVDIWLEETDEMWKQRQNANLVNLYRTARPCVDHWREHCQQSQARDGFyrrkADK 683  Chaetomi...
EJT72042           844 AKEKRRRKEHQALAKLCYKATIADAFIGAMSRQLGESQWMEEEARRADSAQVTAQAVQGWAAQTAEHEEMEDA----AQR 919  Gaeumann...
XP_003716757       933 ESEKLRQRQLDLKSQRFRRRALLAPFVCLMRSQICHNDEAHKLAYGIDLRNVASSIIQAWTAAAGELESM-------AHD 1005 Pyricula...
XP_001585650       727 QDTRSRRWEREEIARRHDNKTVAASVLRRWYVKMNDRAEIEARAADFQAPRILGQCFDSMRTQLQRIVKLNKV----ARA 802  Scleroti...
EED21482           744 AQFYF---ITTKFIKLWHNAALDASKKRRQEAYVKIRRKVKMNIAASALRVWYDKSRRMTNLHNQANELMQT---KLLIY 817  Talaromy...
O13652             587 ADLFFkrkTLRVVFEHWRYLRETNMLLRLENKVVDFREVQSEKLVLRCWNAWVARLLSVSQMLDTAELSTQKvvvRAYEA 666  Schizosa...
EAA26776           905 QSKRF---TIASVLDRWPFLAEQARRERMMTSLRSFRHSYKISLAQSCLSTWFNALLEADDLSADADALHLD---HNHSD 978  Neurospo...
XP_006691266      1892 SRKRS---LVKGVLEDWRINAKQARRDRLMSRLRQFRRQYKVDLAQSCLDKWQDAAADALDAKADADQINIE---YKRAD 1965 Chaetomi...
XP_003657393       676 HRARS---IVSSVLRKWPDIAETARRQRMMNSLRQFRRKYKVELAQECLGKWLDATAEAVEAGHDAHRANLY---YERED 749  Thermoth...
jgi:MYCTH_2130496  700 HRARS---IVSAVLEKWPAVAETARRERMMTSLRQFRRKYKVELAQECLGKWLDATVDALDAQHDARQTNLH---YKRED 773  Thermoth...
Q2GUV2             684 QRARS---IVSNVLDRWPAVAEATRRERMMTSLRQFRRSYKVELAQECLGKWLDATAYAFDAHHDARQANLH---YKRED 757  Chaetomi...
EJT72042           920 GAFYV---GAINCLHAWPRLAKAARQERLRLTYLAFRRNMKIERRAGCLAVWREATYNSAVTAWEFERRRQE---QLLDE 993  Gaeumann...
XP_003716757      1006 ARLGAywtAAITCLEGWPSFAREVRRHRLATTYHAASRLRKERMATDAFVTWQEALHDKFVVTWESEAALQD---RQLHE 1082 Pyricula...
XP_001585650       803 ANKFF---VMNSALKKWRQATQKSKREKRKTAYIQVRRNRKLYLAGDMFSRWRQKAQEKMALNEQALQFAQG---KTFII 876  Scleroti...
EED21482           818 STELVSRWREKTAKITQDTQDAEVYYHRQLAYHQLSRWMDECEIYRGLEEQAEVLDLIRISGVVSAQLRKLSLRIFQIRS 897  Talaromy...
O13652             667 -------WSFRYNHQKEIMSQADQFYNERLMRSAMVFWRYQLRAIKFYFNISDWKRREFNRQTLRNAFDAWHLLMFRVTS 739  Schizosa...
EAA26776           979 LYETLGYWSSIA----RRAQEMRETAADAELDTYLENWMDSAAEMREAEMDAEEWEAVGTMKGC---LQRWEHEALHLVA 1051 Neurospo...
XP_006691266      1966 INDGLDHWRDSA----KRNEDINNIAADAELEVYTNKWQDRLDEHRENMQDAVDYDAEKTRAQT---MEKWEVQALQQKS 2038 Chaetomi...
XP_003657393       750 LNDCLDFWAETA----KKAQDIQQIAADAELEVYCGKWQAQLHEAQENMADAIEYDAEKTRRQC---WEKWEFQTLQQQS 822  Thermoth...
jgi:MYCTH_2130496  774 LNECLDLWNQAA----KRAEGIQQIAADAEVEVYCVKWQAQLQEAKENMQDAIEYDAEQTRKRC---WEKWEFQNLQNES 846  Thermoth...
Q2GUV2             758 LNDCLDLWVRAA----KRLENVQQIAADAEVEVYCEKWHAQLQEAKENMQDAVEYDAEQTRKRC---WEKWEFQNLQNES 830  Chaetomi...
EJT72042           994 MVDWLNDWIGET----NRMIGMGQTAVEVGTEAAVGAWRGAASRLEATWSDAAAYEAEAVATAR---LEDWELRLVTIRG 1066 Gaeumann...
XP_003716757      1083 TIDLMNTWIGET----NRMIVMSSVANQADLQVNVNSWRAIASGLENQETDAVIYDIERLRSAT---LEVWELELVKLRG 1155 Pyricula...
XP_001585650       877 GMNSFDQWRART----EEVAELEPLWKEVVMRKFFNRWKDRTESLQVLNIEATLDFQERQQSDA---LRKWSLRTMQTRA 949  Scleroti...
EED21482           898 AAEMAESLHDRISRKHHRNMLRHWSAKV 925  Talaromyces stipitatus ATCC 10500
O13652             740 LVMQADRFHEQKKNKLLGKYFRKWLQRM 767  Schizosaccharomyces pombe 972h-
EAA26776          1052 KRNAVKALREREERRLAAGVLEGWWAVV 1079 Neurospora crassa OR74A
XP_006691266      2039 KRHMADGMKDRYDKRVVRQILGDWQQKA 2066 Chaetomium thermophilum var. thermophilum DSM 1495
XP_003657393       823 KRHMANTLQEKHERRLCGEVLYEWQQQA 850  Thermothielavioides terrestris NRRL 8126
jgi:MYCTH_2130496  847 KRHMAATLQEKNERRVCRRILAEWQQKA 874  Thermothelomyces thermophilus ATCC 42464
Q2GUV2             831 KRHMAVTLKEKNERRVRRRILGEWQQKA 858  Chaetomium globosum CBS 148.51
EJT72042          1067 REHTASGLAEKNRKRLARQALGFWLGQl 1094 Gaeumannomyces tritici R3-111a-1
XP_003716757      1156 WTHTATELADKNKKKLARQALGFWLSQT 1183 Pyricularia oryzae 70-15
XP_001585650       950 MANTAKELHDKNTRKGHRKMFNYWRQRT 977  Sclerotinia sclerotiorum 1980 UF-70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap